Align glucokinase (EC 2.7.1.2) (characterized)
to candidate NP_660914.1 CT0008 Rok family protein
Query= reanno::SB2B:6937235 (310 letters) >NCBI__GCF_000006985.1:NP_660914.1 Length = 307 Score = 192 bits (489), Expect = 6e-54 Identities = 123/308 (39%), Positives = 164/308 (53%), Gaps = 17/308 (5%) Query: 1 MYRSGIDLGGTKIELVTLNEKGEEVFRKRVPTPKD--YRATLEAVAGLVHDSEKETGQ-- 56 M R GIDLGGTKIE V L+ + + R R+PT ++ Y L + LV +++G Sbjct: 1 MNRWGIDLGGTKIEGVILDSELRPLIRHRIPTGQEQGYGHILMQIKSLVGTMAEKSGLGL 60 Query: 57 VSSVGIGIPGVVSAVTGRVKNSNAVWLNGQPMDKDLGAMLGREVRIANDANCFAVSESVD 116 +GIG PG G + NSN + LNG P+ +DL L EV I NDANCFA++ES+ Sbjct: 61 PEKIGIGTPGRADGSDGVISNSNTICLNGMPLLRDLQEALRLEVVIDNDANCFALAESML 120 Query: 117 GGGAGK-----TLVFGAILGTGCGAGIAINHKVHGGGNGIGGEWGHNPLPWMTADEFNST 171 G G + FG ILGTG G GI + ++ G +GI GEWGHNPLP A Sbjct: 121 GAGRDEMARPGATAFGIILGTGVGGGIVRDGRIIRGAHGIAGEWGHNPLPGEHA------ 174 Query: 172 RCFCGNADCIETFVSGTGFVRDFRAHGGEAASGIEIVALMGKGEPLAEAAFGRFIDRLAR 231 C+CG C+ET VSG R + A G AS EI A G+ + A R + + Sbjct: 175 ACYCGRRGCVETVVSGPALERHYAALSGRKASLQEIAASTGR-DRFARQTIERLVSKFGV 233 Query: 232 ALAHVINLLDPDVIVLGGGVSNIDEIYE-YLPALLPKYVLGGECATKVVKNHHGASSGVR 290 ALA VIN+LDPD++++GGGV NI ++Y + V ++ G S+GV Sbjct: 234 ALATVINILDPDLVIIGGGVGNIRQLYSPEARQAIAANVFNRSFDIPLLPPMLGDSAGVF 293 Query: 291 GAAWLWAP 298 GAA L P Sbjct: 294 GAALLSGP 301 Lambda K H 0.318 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 307 Length adjustment: 27 Effective length of query: 283 Effective length of database: 280 Effective search space: 79240 Effective search space used: 79240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory