Align glucokinase (EC 2.7.1.2) (characterized)
to candidate NP_662883.1 CT2007 glucokinase
Query= BRENDA::Q8RDE9 (315 letters) >NCBI__GCF_000006985.1:NP_662883.1 Length = 336 Score = 192 bits (489), Expect = 7e-54 Identities = 116/319 (36%), Positives = 169/319 (52%), Gaps = 13/319 (4%) Query: 7 GVDLGGTKISTGIVDENGNIIKSIKIPTMAEKGPDVVIERIE---ESIYQVLKDTGLEMS 63 G+DLGGT I +VDE I+ PT GPD V+ ++ +YQ +T L+ Sbjct: 7 GIDLGGTNIKIAVVDELKGILFEDTQPTDVPSGPDGVVRQLAFMASELYQRATET-LDAG 65 Query: 64 NLKGIGIGSPGPLNAKKGIVISPPNLPHWSNVPIVEILSKRL------GIEVRLENDANA 117 GIG+G+PG ++A+KG + PPNLP W V + + L RL V +ENDANA Sbjct: 66 EFAGIGLGAPGAVDAEKGTLSYPPNLPGWGRVALRDELRLRLEEAHSLSSPVIIENDANA 125 Query: 118 AAIGEHLFGSGRGVDNFVYITVSTGIGGGVIIEGKLYSGENSNAAEIGHHTINFDGPRCN 177 AA GE +FG G +F+ +T+ TG+GGG+I++ KLY G A EIG ++F+G + Sbjct: 126 AAYGEAIFGGGNAFRDFMLVTLGTGVGGGIILDRKLYRGPTGTAGEIGFMIVDFEGESVH 185 Query: 178 CGNYGCFEAYASGTAIARFA-REGIEKGIKTKIKELAGE--GEVKAEHVFEAAKLGDEFA 234 G G E I A E I ++ EL + H+ +AA+ GD A Sbjct: 186 AGIRGTIEGLIGKERIVEMACSEQIGAERSPRLAELCNRDFSRLSPRHLEQAAREGDAAA 245 Query: 235 KELVEKEAFYLGVGIANIMAFYNPRKIAIGGGVSAQWDMLYEKMMETVRKKALKPNAEVC 294 E+ LGVG+ANI A + RK IGGG++A +++++ M + + L + Sbjct: 246 LRTWERIGTILGVGLANITALMDIRKFVIGGGIAAAGELIFKPAMMQLHRSTLPSMHDGL 305 Query: 295 EVVKAQLGENIGVLGAAAL 313 E+V A+LG G+ GAAAL Sbjct: 306 EIVPARLGNKAGIYGAAAL 324 Lambda K H 0.316 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 336 Length adjustment: 28 Effective length of query: 287 Effective length of database: 308 Effective search space: 88396 Effective search space used: 88396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory