Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; EC 1.1.1.138 (characterized)
to candidate Pf1N1B4_730 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= SwissProt::O93868 (262 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_730 Length = 252 Score = 124 bits (312), Expect = 1e-33 Identities = 84/260 (32%), Positives = 136/260 (52%), Gaps = 19/260 (7%) Query: 7 ISFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAKDAVEVTEKVGKEFGVKTKAY 66 + +K II+TGG +G+G + +A GA +A++ + ++ ++ T K GV+ +AY Sbjct: 1 MQLTDKVIIITGGCQGLGRSMAEYLAGKGAKLALVDLN-QEKLDATVAACKAKGVEARAY 59 Query: 67 QCDVSNTDIVTKTIQQIDADLGAISGLIANAGVS------VVKPA--TELTHEDFKFVYD 118 C+V++ + VT Q+ D GAI GLI NAG+ VK T+++ ++ V D Sbjct: 60 LCNVADEEQVTHMAAQVADDFGAIHGLINNAGILRDGLLLKVKDGEMTKMSLAQWQAVID 119 Query: 119 VNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMSSQIINQSSLNGSLTQVFYNSSKAACSN 178 VN+ GVF R VA ++ Q G+I+ SS+S G++ Q Y+++KA + Sbjct: 120 VNLTGVFLCTREVAAKMIELQNSGAIINISSISRA--------GNVGQTNYSAAKAGVAA 171 Query: 179 LVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDKKIRDHQASNIPLNRFAQPEEMTGQAI 238 A E A GIRV ++PG++ T+ T M + + S IPL R +PEE+ A Sbjct: 172 ATVTWAKELARYGIRVAGIAPGFIETEMTLSMKPEALEKMTSGIPLKRMGKPEEIAQSAA 231 Query: 239 LLLSDHATYMTGGEYFIDGG 258 + + Y TG +DGG Sbjct: 232 YIFEN--DYYTGRILELDGG 249 Lambda K H 0.317 0.130 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 252 Length adjustment: 24 Effective length of query: 238 Effective length of database: 228 Effective search space: 54264 Effective search space used: 54264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory