Align UTP--glucose-1-phosphate uridylyltransferase; Alpha-D-glucosyl-1-phosphate uridylyltransferase; General stress protein 33; GSP33; UDP-glucose pyrophosphorylase; UDPGP; Uridine diphosphoglucose pyrophosphorylase; EC 2.7.7.9 (characterized)
to candidate SM_b21324 SM_b21324 glucose-1-phosphate thymidylyltransferase
Query= SwissProt::Q05852 (292 letters) >FitnessBrowser__Smeli:SM_b21324 Length = 293 Score = 84.3 bits (207), Expect = 3e-21 Identities = 69/228 (30%), Positives = 106/228 (46%), Gaps = 30/228 (13%) Query: 6 KAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKSKRAIE 65 K II A G GTR P T ++ K++LP+ DKP I Y + + AGI +I+++T R Sbjct: 2 KGIILAGGRGTRLYPVTISVSKQLLPVHDKPMIYYPLGMLMLAGIREILVITMPRDR--- 58 Query: 66 DHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNFIGDEP 125 P E L + + L I Y Q EP GL A R+FIG+ Sbjct: 59 ------PLFEELLGDGSQFGLA-----------ISYAEQPEPNGLAEAFIIGRDFIGNSS 101 Query: 126 FAVLLGDDIVQAETPGLRQL-MDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEGRRYQ 184 A++LGD+I GL +L D + + I +V + E RYG++ + +G + Sbjct: 102 VALILGDNIFYG--AGLPELCSDAAARPSGATIFAYRVDDPE--RYGVV---SFDGETGR 154 Query: 185 VKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTD 232 + EKP A S+ A+ G Y + + + A GE+++TD Sbjct: 155 AETIEEKPE--LARSSWAVTGLYFYENSVLEIASSIKPSARGELEITD 200 Lambda K H 0.317 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 293 Length adjustment: 26 Effective length of query: 266 Effective length of database: 267 Effective search space: 71022 Effective search space used: 71022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory