Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate SMc01979 SMc01979 sugar transport system permease ABC transporter protein
Query= uniprot:A3DE71 (289 letters) >FitnessBrowser__Smeli:SMc01979 Length = 277 Score = 184 bits (468), Expect = 1e-51 Identities = 99/282 (35%), Positives = 172/282 (60%), Gaps = 10/282 (3%) Query: 12 RKKKIKDTIANIILAIL-VVLTLGPIVFMVLTSLMDHNAI-ARGKWIAPTRFS--NYVEV 67 R K+ TIA+ + + + L P+ +++ ++ ++ + + G + P+R S ++ V Sbjct: 2 RAKQAFLTIAHRLAVLAYIAFALFPLFWLLKVAVTPNDLLYSEGIRLWPSRASLEHFDFV 61 Query: 68 FQKLPFGIYFRNSLIVCSIVMVVALVIATLAGYSLAKYKFPGSGFFGILILATQLLPGMM 127 + F ++FRNSLIV V+ ++A+L+GY+L++++F G + L+L TQ+ P +M Sbjct: 62 LRHSAFPVFFRNSLIVSGSTAVIVTILASLSGYALSRFRFRGKYWLVTLMLLTQMFPLVM 121 Query: 128 FLLPLYLDFVKIKQATGIQLINSIPGLVIVYSAFFVPFSIWIIRGFFASIPGELEEAARI 187 + P++ K + + L NS+ GLV+VY+AF VPF+ ++++ FF IP +LEEAA I Sbjct: 122 LVAPIF------KILSPLGLTNSLTGLVVVYTAFNVPFATFLMQSFFDGIPKDLEEAAMI 175 Query: 188 DGCNKFTAFLRVMLPLAVPGIVATAIYIFLTAWDELIFAWVLLKDTKVTTIPAGIRGFIA 247 DG +F AF +++LPL +PGI AT ++F AW EL+F+ +L+ T P G+ F++ Sbjct: 176 DGATQFVAFRQIILPLTLPGIAATLGFVFTAAWSELLFSLMLISGNAQATFPVGLLSFVS 235 Query: 248 YTTARYDLLMAAGTIVTIPVLIMFFTMQKKFISGMTAGAVKG 289 + + +MAAG + IP + F +Q+ + G+TAGAVKG Sbjct: 236 KFSVDFGQMMAAGVLALIPACLFFLLIQRYLVQGLTAGAVKG 277 Lambda K H 0.332 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 277 Length adjustment: 26 Effective length of query: 263 Effective length of database: 251 Effective search space: 66013 Effective search space used: 66013 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory