Align TreU, component of Trehalose porter (characterized)
to candidate SMc01979 SMc01979 sugar transport system permease ABC transporter protein
Query= TCDB::Q97ZC1 (267 letters) >FitnessBrowser__Smeli:SMc01979 Length = 277 Score = 118 bits (295), Expect = 2e-31 Identities = 80/257 (31%), Positives = 130/257 (50%), Gaps = 5/257 (1%) Query: 15 YFLFPLYILVLLAFNSPKYTVLAKFPSLLPVSLTLNNLLTALQGTAFIDPFIKSLETATL 74 + LFPL+ L+ +A +P + ++ L P +L + L+ +AF F SL + Sbjct: 22 FALFPLFWLLKVAV-TPNDLLYSEGIRLWPSRASLEHFDFVLRHSAFPVFFRNSLIVSGS 80 Query: 75 VGIITIALAIPAGYGLSRLPRAIAYSIIILLLVTNMMPAIVIGIPIAVDFLKLHLFESVV 134 +I LA +GY LSR Y ++ L+L+T M P +++ PI L L S+ Sbjct: 81 TAVIVTILASLSGYALSRFRFRGKYWLVTLMLLTQMFPLVMLVAPIFKILSPLGLTNSLT 140 Query: 135 GLALAQTLITLPLATFILQGTFSSIPIDLEHQARVDGANLFNRLFSVLLPLAAPGIAAAF 194 GL + T +P ATF++Q F IP DLE A +DGA F ++LPL PGIAA Sbjct: 141 GLVVVYTAFNVPFATFLMQSFFDGIPKDLEEAAMIDGATQFVAFRQIILPLTLPGIAATL 200 Query: 195 LISWMFSWDEFTYAILLIP--YHSTLPVTIYQDVTRGNLLAG--IAFSLIFTLPVIILTF 250 + +W E ++++LI +T PV + V++ ++ G +A ++ +P + Sbjct: 201 GFVFTAAWSELLFSLMLISGNAQATFPVGLLSFVSKFSVDFGQMMAAGVLALIPACLFFL 260 Query: 251 ALQKYLRGEYLAGGIKG 267 +Q+YL AG +KG Sbjct: 261 LIQRYLVQGLTAGAVKG 277 Lambda K H 0.330 0.146 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 277 Length adjustment: 25 Effective length of query: 242 Effective length of database: 252 Effective search space: 60984 Effective search space used: 60984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory