Align ABC transporter permease (characterized, see rationale)
to candidate SMc02472 SMc02472 ABC transporter permease
Query= uniprot:A0A165KPZ4 (293 letters) >FitnessBrowser__Smeli:SMc02472 Length = 312 Score = 122 bits (306), Expect = 1e-32 Identities = 86/275 (31%), Positives = 138/275 (50%), Gaps = 14/275 (5%) Query: 11 PKLVVAPAFVL---GFAFIYGLMVWNGVLSLTVSRMLPNYEWAGLAQYERLWEMDRWWVA 67 P L++ FV+ G A Y L WNG + T ++ GL +E L+ + A Sbjct: 40 PALLLFTVFVILPMGEAAWYSLYRWNGYGTPT--------QFVGLRNFEVLFNNAAFSRA 91 Query: 68 LKNLGIFGVGYVGGSLLIGVVLAVLLDQKIRAEGALRTIYLYPMALSFVVTGTAWKWLLN 127 L N GI + V + + + LA++L +I A R I+ P L+ V G W+++ + Sbjct: 92 LINNGIIILVSVLLQIPLALWLAMMLAHRIAGVVAFRLIFFLPYVLADVAAGLIWRFVYD 151 Query: 128 PGLGIEKMVRDWGFPNFEFGW-LVDTEMAIYCVVIAGIWQSAGFAMALFLAGLRGIDDSI 186 G+ + GF + L D +AIY V+ IW+ GF M LF+AGL+ +D S+ Sbjct: 152 GDYGLVAAIA--GFFGVATPYVLADRSLAIYAVLAVIIWKYFGFHMMLFIAGLQAVDRSV 209 Query: 187 IKAAQVDGASLPRIYWRIVLPALRPVFFSTLMVLSHLAIKSFDLVMALTAGGPGFATDVP 246 ++AA++DGA+ + + + LP L ++ +++ FDLVM LT GGP +T Sbjct: 210 LEAAEIDGATGWQKFRYVTLPLLGSTVRLSIFFAVIGSLQLFDLVMPLTGGGPSNSTQTM 269 Query: 247 ATFMYTMSFSRGQIGLGAASATMMLATVAALVIPY 281 TF+YT +R Q+GLG+A ++ L Y Sbjct: 270 VTFLYTYGVTRMQVGLGSAVGVVLFVICVTLAFGY 304 Lambda K H 0.327 0.141 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 312 Length adjustment: 27 Effective length of query: 266 Effective length of database: 285 Effective search space: 75810 Effective search space used: 75810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory