Align L-fucose mutarotase (EC 5.1.3.29) (characterized)
to candidate SMc03002 SMc03002 hypothetical protein
Query= reanno::Smeli:SM_b21108 (109 letters) >FitnessBrowser__Smeli:SMc03002 Length = 104 Score = 60.1 bits (144), Expect = 7e-15 Identities = 34/108 (31%), Positives = 58/108 (53%), Gaps = 7/108 (6%) Query: 1 MQRMGMVIGLEPSKIAEYKRLHAAVWPEILALISECNITNYSIFLKEPENLLFGYWEYVG 60 M++ + L P K AEY+ H A+WPE++ L+ + +++YSI L E LLFG + Sbjct: 1 MEKYAFRMRLHPGKAAEYQARHDAIWPELVTLLKDAGVSDYSIHLDEENCLLFG---VLW 57 Query: 61 EDFEADMTKMAAHPKNQEWWSVCMPCQKPLESRRQGEWWAM-MEEVFH 107 + M + +HP ++WW+ +E+R E A+ ++ VFH Sbjct: 58 RSDDHRMGDLPSHPVMRKWWAHMADI---METRADNEPVAVPLKTVFH 102 Lambda K H 0.321 0.134 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 45 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 109 Length of database: 104 Length adjustment: 12 Effective length of query: 97 Effective length of database: 92 Effective search space: 8924 Effective search space used: 8924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 40 (20.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory