Align BztA, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate Synpcc7942_0246 Synpcc7942_0246 extracellular solute-binding protein, family 3
Query= TCDB::Q52663 (338 letters) >FitnessBrowser__SynE:Synpcc7942_0246 Length = 359 Score = 305 bits (780), Expect = 1e-87 Identities = 151/320 (47%), Positives = 211/320 (65%), Gaps = 3/320 (0%) Query: 21 SASTLDDVKARGQLICGSNPGLTGFAAPDANGVYQGFDVAVCKAVAAAVLGDPMKVKYVP 80 S S L+ V+ARG+L+CG L GF+ D+ G Y G DV +CKA+AAA+ DP ++Y Sbjct: 41 SNSRLNQVQARGKLLCGVEGRLPGFSFLDSQGNYSGLDVDICKAIAAALFNDPKAIEYRS 100 Query: 81 LTGETRFTALASGEVDVLVRNSTWTFSRDTELA--LDFVAVNYYDGQGFMVNKSLGVSSA 138 L RF ALASGEVD+L RN+TWT SRD + L+F +YDGQG MV ++ G+ S Sbjct: 101 LDSVERFPALASGEVDLLSRNTTWTLSRDAKGGNNLEFAPTTFYDGQGLMVRRNSGIQSL 160 Query: 139 KELDGATICVQTGTTTEMNLADFFKANNMTYTPVNIADDAEGQQKFAAGACDSYTTDASG 198 ++ G +ICV+TGTT+E+NLAD + + Y + + +A G C+ T+D S Sbjct: 161 QDFQGKSICVETGTTSELNLADTMRELGVQYQEIKFPNSDANYAAYAQGRCEGVTSDRSQ 220 Query: 199 LASSRATLPNAADIVILPEIISKEPLGPVVRHGDNNWGDIVRWSFYALVAAEEYGITKAN 258 LA+ R TL +A +L +ISKEPL P + D+ W D+V+W A + AEE+GIT+AN Sbjct: 221 LAARRTTLSDADQHQLLDAVISKEPLSPATLNNDSPWFDVVKWVVNATIQAEEFGITQAN 280 Query: 259 LEEVAASTQNPEIRRLLGLEGDMGKKIGLDNDFAKRAILASGNYGEVFEANIGASTSIGL 318 +++ S +NPEIRR LGLEG++G+++GL NDFA RAI A GNYGE++E N+G + + L Sbjct: 281 IDQFKTS-KNPEIRRFLGLEGELGQQLGLSNDFAYRAIKAVGNYGEIYERNVGQQSPLKL 339 Query: 319 ARGLNAQWTQGGLMYAPPFR 338 RGLN + GGL+Y+PPFR Sbjct: 340 NRGLNQLYKNGGLLYSPPFR 359 Lambda K H 0.316 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 359 Length adjustment: 29 Effective length of query: 309 Effective length of database: 330 Effective search space: 101970 Effective search space used: 101970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory