Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate Synpcc7942_0249 Synpcc7942_0249 ATPase
Query= TCDB::A3ZI83 (242 letters) >FitnessBrowser__SynE:Synpcc7942_0249 Length = 261 Score = 229 bits (585), Expect = 3e-65 Identities = 121/242 (50%), Positives = 172/242 (71%), Gaps = 3/242 (1%) Query: 1 MIELKNVNKYYGTH-HVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVV 59 MI + V K+YG L ++L+V+ GE +V++GPSGSGKST +R +N LE GE+ Sbjct: 21 MIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIW 80 Query: 60 VNNLVLNHKNK-IEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFK 118 + L+H + I R+ MVFQ FNL+PH+TVLQNL LAP+++++ +AE TA + Sbjct: 81 IEGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQ 140 Query: 119 YLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVM 178 L+ V + ++A+ YP LSGGQQQRVAIAR+L + +LFDEPTSALDPE ++EVLDVM Sbjct: 141 LLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVM 200 Query: 179 KEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARLFLGK 238 ++++ + TM+V THE+GFA+EVADR++ M DG IVEE P FF+ P+++RA+ FL + Sbjct: 201 RDLASE-GMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQ 259 Query: 239 IL 240 IL Sbjct: 260 IL 261 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 3 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 261 Length adjustment: 24 Effective length of query: 218 Effective length of database: 237 Effective search space: 51666 Effective search space used: 51666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory