Align N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; Amidohydrolase domain-containing protein 2; EC 3.5.1.25 (characterized)
to candidate Synpcc7942_0440 Synpcc7942_0440 N-acetylglucosamine 6-phosphate deacetylase
Query= SwissProt::Q9Y303 (409 letters) >FitnessBrowser__SynE:Synpcc7942_0440 Length = 375 Score = 193 bits (491), Expect = 6e-54 Identities = 129/353 (36%), Positives = 192/353 (54%), Gaps = 20/353 (5%) Query: 57 DCGGRILAPGFIDVQINGGFGVDFSQATEDVGSGVALVARRILSHGVTSFCPTLVTSPPE 116 D G L+ G ID+QING G+ F + + + + RR+ GV +F PTLVTS Sbjct: 23 DLQGDWLSLGGIDLQINGALGLAFPEVQASDRNRLLAICRRLWEQGVDAFTPTLVTSSIA 82 Query: 117 VYHKVVPQIP---VKSGGPHGAGVLGLHLEGPFISREKRGAHPEAHLRSFEADAFQDLLA 173 + + + I + P A +LGLHLEGP ++ KRGAHP+ HL+ + ++ Sbjct: 83 QFRQAIEAIADFVAQPLPPRHAKILGLHLEGPCLAESKRGAHPQEHLQPLTVEVLSEICG 142 Query: 174 TYGPLDNVRIVTLAPELGRSHEVIRALTARGICVSLGHSVADLRAAEDAVWSGATFITHL 233 + L +RIVTLAPEL + E I L +G+ VSLGHS A A+ A GAT +TH Sbjct: 143 DH--LAQIRIVTLAPELDPTGEAIAWLRQQGVIVSLGHSQATAEQAQVAFQQGATMVTHA 200 Query: 234 FNAMLPFHHRDPGIVG-LLTSDRLPAGRCIFYGMIADGTHTNPAALRIAHRA--HPQGLV 290 FNAM P HHR PG++G LT+D +F G+IADG H +P L++ RA + L Sbjct: 201 FNAMPPLHHRQPGLLGAALTTD------TVFAGLIADGQHIDPIMLKLLLRAGEGDRRLF 254 Query: 291 LVTDAIPALGLGNGRHTLGQQEVEVDGLTAYVAGTKTLSGSIAPMDVCVRHFLQATGCSM 350 LV+DA+ LGL +G++ ++++ V T + TL+G+ P+ V++ ++ C Sbjct: 255 LVSDALAPLGLPDGQYPWDERQITVTAGTCRLE-DGTLAGTTLPLLAGVQNLVRWQVCEP 313 Query: 351 ESALEAASLHPAQLLGLEKSKGTLDFGADADFVVLDDSLHVQATYISGELVWQ 403 E+A+ A+L P + LG++ S L + + +L H T GEL WQ Sbjct: 314 ETAIMLATLAPLRALGVDWSDPRLLYLSRPVCQLL--RWHQSDT---GELTWQ 361 Lambda K H 0.322 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 409 Length of database: 375 Length adjustment: 31 Effective length of query: 378 Effective length of database: 344 Effective search space: 130032 Effective search space used: 130032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate Synpcc7942_0440 Synpcc7942_0440 (N-acetylglucosamine 6-phosphate deacetylase)
to HMM TIGR00221 (nagA: N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00221.hmm # target sequence database: /tmp/gapView.10894.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00221 [M=380] Accession: TIGR00221 Description: nagA: N-acetylglucosamine-6-phosphate deacetylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-82 263.7 0.0 1.7e-82 263.3 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_0440 Synpcc7942_0440 N-acetylglucosam Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_0440 Synpcc7942_0440 N-acetylglucosamine 6-phosphate deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 263.3 0.0 1.7e-82 1.7e-82 38 349 .. 12 331 .. 3 335 .. 0.95 Alignments for each domain: == domain 1 score: 263.3 bits; conditional E-value: 1.7e-82 TIGR00221 38 aele.eeikeidlkgnvltpGliDvqlnGcgGvdtnd.asv..etleimsealaksGvtsfLptlitre 102 ++l+ ++ ++idl+g l+ G iD+q+nG+ G + + +++ + l + ++l ++Gv +f ptl+t + lcl|FitnessBrowser__SynE:Synpcc7942_0440 12 DRLPpPQLRMIDLQGDWLSLGGIDLQINGALGLAFPEvQASdrNRLLAICRRLWEQGVDAFTPTLVTSS 80 55554899***************************9864545889************************ PP TIGR00221 103 deeikkavkvareylakekn...akiLGlhleGPflslekkGahpkeyirepdvellkkfldeagdvit 168 + + ++a++++ +++a+ akiLGlhleGP l+ k+Gahp+e++++ +ve+l ++ + i+ lcl|FitnessBrowser__SynE:Synpcc7942_0440 81 IAQFRQAIEAIADFVAQPLPprhAKILGLHLEGPCLAESKRGAHPQEHLQPLTVEVLSEICGDHLAQIR 149 ****************9754456*********************************9999999999*** PP TIGR00221 169 kvtlapeekqtaelisklleagiivsaGhtnatyeelkeafkaGitfathlynamskldhRepgviGav 237 +vtlape+++t e i l ++g+ivs+Gh++at e+++ af++G+t +th +nam++l+hR+pg++Ga+ lcl|FitnessBrowser__SynE:Synpcc7942_0440 150 IVTLAPELDPTGEAIAWLRQQGVIVSLGHSQATAEQAQVAFQQGATMVTHAFNAMPPLHHRQPGLLGAA 218 ********************************************************************* PP TIGR00221 238 LdeddvvteiiaDGlhihpknirlakkl.kgdsklvlvtDslaaagaklekfifaGkevyiredtlldk 305 L d v +++iaDG hi+p ++l+ ++ gd +l lv D+la+ g++++++ +++++ +t+ + lcl|FitnessBrowser__SynE:Synpcc7942_0440 219 LTTDTVFAGLIADGQHIDPIMLKLLLRAgEGDRRLFLVSDALAPLGLPDGQYPWDERQITVTAGTCRLE 287 **********************99877647999************************************ PP TIGR00221 306 ngtlaGssltmiegvknlvefveislsdvvrisslnparalgid 349 +gtlaG++l ++ gv+nlv + + + ++ +++l p ralg+d lcl|FitnessBrowser__SynE:Synpcc7942_0440 288 DGTLAGTTLPLLAGVQNLVRWQVCEPETAIMLATLAPLRALGVD 331 ******************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (380 nodes) Target sequences: 1 (375 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.91 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory