Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate Synpcc7942_0684 Synpcc7942_0684 3-oxoacyl-[acyl-carrier-protein] reductase
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__SynE:Synpcc7942_0684 Length = 249 Score = 118 bits (296), Expect = 1e-31 Identities = 82/250 (32%), Positives = 127/250 (50%), Gaps = 21/250 (8%) Query: 16 LISGGAAGIGEVLAAAYLEAGAQVHV-----CDVSESALAVFRDKYPGTVATRADVSDAA 70 L++G + GIG +A AGA+V V ++ +A A +ADVS + Sbjct: 12 LVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGGEAFAVKADVSQES 71 Query: 71 QIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHHAVP 130 ++EA+F E G LDVLVNNAGI T + D +WQ+ +++NL + + A Sbjct: 72 EVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRD-DWQSVLDLNLGGVFLCSRAAAK 130 Query: 131 MLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPGI 190 ++ + G +++IASV G +G + Y+A K ++GL K++A EL I VNA+ PG Sbjct: 131 IMLKQRSGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGF 190 Query: 191 VEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCS-PAARNVT 249 + D AE++ L I L R A +VA + FL + PAA +T Sbjct: 191 I---ATDMTSELAAEKL-----------LEVIPLGRYGEAAEVAGVVRFLAADPAAAYIT 236 Query: 250 GQAISVDGNV 259 GQ I++DG + Sbjct: 237 GQVINIDGGL 246 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 249 Length adjustment: 24 Effective length of query: 238 Effective length of database: 225 Effective search space: 53550 Effective search space used: 53550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory