Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate Synpcc7942_0684 Synpcc7942_0684 3-oxoacyl-[acyl-carrier-protein] reductase
Query= uniprot:Q8EGC1 (252 letters) >FitnessBrowser__SynE:Synpcc7942_0684 Length = 249 Score = 170 bits (431), Expect = 2e-47 Identities = 105/258 (40%), Positives = 160/258 (62%), Gaps = 23/258 (8%) Query: 1 MDLKDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQ----DKLERACADLGSSTEVQ 56 + L D++ ++TG + G+G A+A A AGAK+A+ D++ A A G E Sbjct: 4 LPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGG--EAF 61 Query: 57 GYALDITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQS 116 D++ E +V A FA ++E +G+++VLVNNAGI RD +L+ RM D +QS Sbjct: 62 AVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLL---------RMKRDDWQS 112 Query: 117 VINVNLTGTFLCGREAAAAMIESGQAGVIVNISSLA-KAGNVGQSNYAASKAGVAAMSVG 175 V+++NL G FLC R AA M++ ++G I+NI+S+ + GN GQ+NY+A+KAGV ++ Sbjct: 113 VLDLNLGGVFLCSRAAAKIMLKQ-RSGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKT 171 Query: 176 WAKELARYNIRSAAVAPGVIATEMTAAMKPEALERLEKLVPVGRLGHAEEIASTVRFIIE 235 AKELA I AVAPG IAT+MT+ + A E+L +++P+GR G A E+A VRF+ Sbjct: 172 VAKELASRGITVNAVAPGFIATDMTSEL---AAEKLLEVIPLGRYGEAAEVAGVVRFLAA 228 Query: 236 ND---YVNGRVFEVDGGI 250 + Y+ G+V +DGG+ Sbjct: 229 DPAAAYITGQVINIDGGL 246 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 249 Length adjustment: 24 Effective length of query: 228 Effective length of database: 225 Effective search space: 51300 Effective search space used: 51300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory