Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate Synpcc7942_0684 Synpcc7942_0684 3-oxoacyl-[acyl-carrier-protein] reductase
Query= reanno::Korea:Ga0059261_1894 (259 letters) >FitnessBrowser__SynE:Synpcc7942_0684 Length = 249 Score = 99.4 bits (246), Expect = 6e-26 Identities = 75/250 (30%), Positives = 120/250 (48%), Gaps = 18/250 (7%) Query: 16 LKGKRVLVTGGGSGIGAGIVEGFARQGADVT--FFDIAGAESQLLVERLSADGHKACFER 73 L + LVTG GIG I A GA V + AGA ++ V ++A G +A + Sbjct: 6 LTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEV-VAAIAAAGGEAFAVK 64 Query: 74 VDLTDVASLQAVIARLIKGAGGFDILVNNAANDDRHAIDEITEAYWDERLSVNLKHIFFC 133 D++ + ++A+ A +I+ G D+LVNNA + + W L +NL +F C Sbjct: 65 ADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGGVFLC 124 Query: 134 AQAVVPAMRARGGGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDGIRAT 193 ++A M + G I+N+ S+ +G Y KA + GLT+++A++L GI Sbjct: 125 SRAAAKIMLKQRSGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVN 184 Query: 194 CVIPGNVRTPRQLKWYSPEGEAEIVAAQCLD----GRLA-PEDVAAMVLFLASDD-ARLV 247 V PG + T + +E+ A + L+ GR +VA +V FLA+D A + Sbjct: 185 AVAPGFIAT---------DMTSELAAEKLLEVIPLGRYGEAAEVAGVVRFLAADPAAAYI 235 Query: 248 TGHSYFVDAG 257 TG +D G Sbjct: 236 TGQVINIDGG 245 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 127 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 249 Length adjustment: 24 Effective length of query: 235 Effective length of database: 225 Effective search space: 52875 Effective search space used: 52875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory