Align ornithine aminotransferase (EC 2.6.1.13) (characterized)
to candidate Synpcc7942_0943 Synpcc7942_0943 acetylornithine aminotransferase
Query= BRENDA::Q98TS5 (439 letters) >FitnessBrowser__SynE:Synpcc7942_0943 Length = 422 Score = 263 bits (672), Expect = 8e-75 Identities = 147/412 (35%), Positives = 224/412 (54%), Gaps = 12/412 (2%) Query: 35 EEALSSEYVFDRESKYGAHNYHPLPVALERGKGVYVWDVEGRRYFDFLSAYSAVNQGHCH 94 + A++S + D Y P+ALERG+G VWD +GR Y DF++ + GH H Sbjct: 11 DAAIASPFSTDAFDACVMQTYGRFPLALERGEGCRVWDTQGRSYLDFVAGIATCTLGHAH 70 Query: 95 PKILDALKSQADKLTLTSRAFYNDVLGEYEEYITKIFGYNKVLPMNTGVEGGETACKLAR 154 P+++DA+ Q KL S +Y G+ ++T ++V N+G E E A KLAR Sbjct: 71 PELVDAISDQIRKLHHVSNLYYIPEQGQLAAWLTANSCADRVFFCNSGAEANEAAIKLAR 130 Query: 155 KWAYTVKGIPKYKAQIIFAAGNFWGRTMSAISSSTDPSSYEGFGPFMPGFKIIPYNDLPA 214 K TV + I+ A +F GRT++A++++ P ++GF P + GF+ +PYNDL A Sbjct: 131 KHGNTV--LEAENPIILTAQASFHGRTLAAVTATGQPKYHKGFQPLVQGFRYVPYNDLAA 188 Query: 215 LERALQD-----PNVAAFMVEPIQGEAGVIVPDEGYLTGVRQLCTAHNVLFIADEVQTGL 269 LE L + VAA ++EP+QGE GV D Y VRQLC +L I DEVQ G+ Sbjct: 189 LEATLAELDAAGETVAAILLEPLQGEGGVNPGDRAYFQAVRQLCDQRRMLLILDEVQVGM 248 Query: 270 ARTGKMLAVDHENVRPDLVILGKALSGGVYPVSAVLCDDEVMLTIKPGEHGSTYGGNPLG 329 R+G++ ++ + PD + K L GGV P+ A+L + ++ GEH ST+GGNPL Sbjct: 249 GRSGQLWGYENLGIEPDAFTVAKGLGGGV-PIGALLVKASCNI-LQAGEHASTFGGNPLA 306 Query: 330 CRVAMASLEVIEEEKLAENANXMGELLRA---ELMKTPSDIVTAVRGKGLLNAIVIKQSK 386 CR +A +V+E ++L N GE LRA EL+ +++ VRG GL+N +V++ Sbjct: 307 CRAGLAIAQVMERDQLLANVQARGEQLRAGLQELVDRYPNLLAGVRGWGLINGLVLRNDP 366 Query: 387 DCDAWKVCLRLRDNGLLAKPTHGDIIRLAPPLTIKEDEIRECSEIIHKTLLS 438 + + + GLL P +++R PPL + EI E + + LL+ Sbjct: 367 NVTPIALVKAAIEQGLLLVPAGAEVVRFVPPLIVSAAEIDEALAMTERALLA 418 Lambda K H 0.318 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 422 Length adjustment: 32 Effective length of query: 407 Effective length of database: 390 Effective search space: 158730 Effective search space used: 158730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory