Align ABC transporter for L-Fucose, permease component 2 (characterized)
to candidate Synpcc7942_0948 Synpcc7942_0948 permease protein of sugar ABC transporter
Query= reanno::Smeli:SM_b21105 (288 letters) >FitnessBrowser__SynE:Synpcc7942_0948 Length = 275 Score = 149 bits (376), Expect = 7e-41 Identities = 89/272 (32%), Positives = 143/272 (52%), Gaps = 7/272 (2%) Query: 19 LAGLFLAMLVICLPGLWIVLSSLRPTVEIMAKPPVWIPETLSLDAYRAMFSGAGQGGVPV 78 +A L L++ + P LW +L+S++ +I A P ++ P +++ Y+A++ G Sbjct: 9 IAALALSLFSLA-PILWQLLTSIKVNADIAAIPTIYWPRQWTVEHYQALWQQTPAFG--- 64 Query: 79 WDYFRNSLIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFLGFMLTRAVPGIALSLPLF 138 Y NS +VS +T+ AL IG YA AR R ++ + +L P + L L Sbjct: 65 -RYLLNSAVVSAIATLAALLIGTPCAYAIARRRDRSSQVLVGSLLLVTLFPYVLLFQGLL 123 Query: 139 MLYARTGIIDTHFSLILTYVALNVPFTIWLIDGFFRQVPKDLAEAAQIDGCTPWQAFWQV 198 + + + +L++ Y ALN+P I L+ FF Q+P +L EAAQIDG + Q W + Sbjct: 124 EVVRWLQWGNNYAALVVPYTALNLPLVILLLRSFFEQLPPELEEAAQIDGLSLGQRLWLI 183 Query: 199 EFPLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPVGLLDY--TAEFTIDWRGMC 256 PL P + +AGI AF+ SWNEY LA KT+P+ + + + F + + + Sbjct: 184 LVPLTAPALVTAGILAFIFSWNEYVLALSFISQQALKTVPIAVAEIGGISIFDVPYGDIA 243 Query: 257 ALAVVMIVPALTLTFIIQKHLVSGLTFGAVKG 288 A VV +P + L + Q+ ++ GLT GAVKG Sbjct: 244 AATVVATLPLIGLVLVAQRRILEGLTAGAVKG 275 Lambda K H 0.328 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 275 Length adjustment: 26 Effective length of query: 262 Effective length of database: 249 Effective search space: 65238 Effective search space used: 65238 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory