Align TreV, component of Trehalose porter (characterized)
to candidate Synpcc7942_0960 Synpcc7942_0960 ATPase
Query= TCDB::Q97ZC0 (324 letters) >FitnessBrowser__SynE:Synpcc7942_0960 Length = 417 Score = 232 bits (591), Expect = 1e-65 Identities = 131/334 (39%), Positives = 191/334 (57%), Gaps = 52/334 (15%) Query: 13 GKNIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIADGADITDKPPE 72 G+ +V+NGI +I GEF V++GPSG GKSTLL++LAG+E +G I + P + Sbjct: 45 GEVVVLNGINLEIADGEFMVVVGPSGCGKSTLLRLLAGLETPSRGLIKVGDRRVDRLPAK 104 Query: 73 KRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMK------------------------KEE 108 R++AMVFQ+YALYP++SV DN+AF L+ +G + + Sbjct: 105 ARDIAMVFQSYALYPHLSVYDNLAFGLRRQGDRPWWQQQLALATRSLPKSLQYEPEQEAR 164 Query: 109 IIERVEKAAKLLGISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVR 168 I RV + A +L + +LD++ Q+SGGQ+QRVAL RAI RNP FL+DEPLSNLDA++R Sbjct: 165 IKRRVREVATMLQLDTLLDRQPKQLSGGQKQRVALGRAIARNPQVFLMDEPLSNLDAKLR 224 Query: 169 TTARGELKRIQKELKGTFIYVTHDQKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKW 228 R ++ +Q++L T +YVTHDQ EA+++ DRIA+L++G +QV+ P +Y+ P ++ Sbjct: 225 AETRAQIVSLQRQLGVTTLYVTHDQTEAMTMGDRIAVLNRGHLQQVASPLEIYDRPANRF 284 Query: 229 VAQFVGEFPMNFLPG-------------------------ELMKEKAQEIGFRPEWVEVG 263 VAQF+G PMN +P L + E+G RPE +EVG Sbjct: 285 VAQFIGSPPMNLIPVTVRAPLQLTTENFRCTLPEAWEPVLRLYDGQTVELGIRPEHLEVG 344 Query: 264 KG---NLSCMVESVEASGESRYLICNFKNNNITI 294 NL V VEA G ++ K + I + Sbjct: 345 AAASKNLLITVTGVEALGSDTFIAGELKESGIAV 378 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 417 Length adjustment: 30 Effective length of query: 294 Effective length of database: 387 Effective search space: 113778 Effective search space used: 113778 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory