Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate Synpcc7942_2492 Synpcc7942_2492 ATPase
Query= TCDB::Q8YT15 (247 letters) >FitnessBrowser__SynE:Synpcc7942_2492 Length = 237 Score = 184 bits (466), Expect = 2e-51 Identities = 101/235 (42%), Positives = 147/235 (62%), Gaps = 3/235 (1%) Query: 10 PLLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKI 69 PLL++ + Y V L + + GE+V +IG NGAGKST + I L+ G+I Sbjct: 4 PLLQLSQIAVNY-GAVVALTDLTLEIFPGEIVALIGANGAGKSTTLRAISRLVPLQQGRI 62 Query: 70 TFKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENLEMGAFIRND--SLQPLKDKIF 127 + +++ + + Q+V G+ + P+ V SV NLE+GA+ R D +Q + F Sbjct: 63 YYDQQDLGLIPAPQLVGRGLAHCPEGRRVLARQSVRINLELGAYCRRDRIGIQTDLELQF 122 Query: 128 AMFPRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVTQVFEQVK 187 FPRL +R+ Q AGTLSGGE+QMLA+ +ALM P LL+LDEPS L+P +V ++F ++ Sbjct: 123 DRFPRLRERQNQPAGTLSGGEQQMLAIARALMSRPRLLLLDEPSLGLAPQIVQEIFSVIR 182 Query: 188 QINQEGTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAELYLG 242 + ++G I+LVEQNA AL+ ADRGYVLE+G+ SGP +LL DP+V + YLG Sbjct: 183 SLREQGMTILLVEQNATLALQTADRGYVLEAGQLLFSGPAADLLIDPRVKQAYLG 237 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 237 Length adjustment: 23 Effective length of query: 224 Effective length of database: 214 Effective search space: 47936 Effective search space used: 47936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory