Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_002719435.1 RSPH17029_RS04835 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_000015985.1:WP_002719435.1 Length = 276 Score = 213 bits (542), Expect = 3e-60 Identities = 117/241 (48%), Positives = 162/241 (67%), Gaps = 8/241 (3%) Query: 9 LLQVKGLKVAYGGIQAV-KGVDFEVREGELVSLIGSNGAGKTTTMKAITGTL-----SMN 62 LL+V ++V Y + V KGV +V +G + +L+G NGAGKTTT+KAI+ L + Sbjct: 13 LLEVNNIEVIYNHVILVLKGVSLQVPKGGVTALLGGNGAGKTTTLKAISNLLRSERGEVT 72 Query: 63 DGNIEYLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKD-KAGILAD 121 G I Y G+ ++ LV+ G++ V EGR F +T+ ENL GAY RKD +A ++ D Sbjct: 73 KGAILYRGERVQDLDPATLVRRGVIQVMEGRHCFEHLTVEENLLTGAYTRKDGRAAVMED 132 Query: 122 IEKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMVDKI 181 +E ++T FPRLRER+ AG SGGEQQM+AMGRALMS+P+++LLDEPSMGL+P +V++I Sbjct: 133 LEMVYTYFPRLRERRKSQAGYTSGGEQQMVAMGRALMSRPEMILLDEPSMGLAPQLVEQI 192 Query: 182 FEVVRDV-YALGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDPKVRAAYL 240 FE+VR V GVT +L EQN + AL A GY++ESG + M G Q+L +P V+ YL Sbjct: 193 FEIVRAVNEGEGVTFLLAEQNTNVALRYAHTGYILESGRVVMEGTAQELRENPDVKEFYL 252 Query: 241 G 241 G Sbjct: 253 G 253 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 276 Length adjustment: 24 Effective length of query: 218 Effective length of database: 252 Effective search space: 54936 Effective search space used: 54936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory