Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_002719437.1 RSPH17029_RS04845 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQH9 (318 letters) >NCBI__GCF_000015985.1:WP_002719437.1 Length = 358 Score = 134 bits (337), Expect = 3e-36 Identities = 100/326 (30%), Positives = 161/326 (49%), Gaps = 38/326 (11%) Query: 10 LWL-LLLLAGYSLISVLVSVGVLNLFYVQILQQIGINIILAVGLNLIVGFSGQFSLGHAG 68 LW + L+ G++++ +++ N V L I I A+GLN++ G+ GQ SLG G Sbjct: 27 LWYQVALVVGFAILPFVINDYWANAVVVPFL----IYAIAAIGLNILTGYCGQVSLGTGG 82 Query: 69 FMAIGAYAAAIIGSKSPTYGAFFGAMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVS 128 FMA+GAYA + + P +L GA+ +G V +L G+P+LR+KG YLAVATL + Sbjct: 83 FMAVGAYAVYKLMTAFPDVPILIHVILAGAITAG-VGVLFGLPSLRIKGFYLAVATL-AA 140 Query: 129 EIIRIFIIN----------GGSLTNGAAGILGI----PNFTTWQMVYF---FVVITTIAT 171 + +++ N G +T + GI N W F F+ Sbjct: 141 QFFLVWLFNKVPWFYNYSASGQITAPERTMFGIAVTGANTPAWAKYLFCAAFLFALAWIA 200 Query: 172 LNFLRSPIGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSL-QAGFIGSV- 229 N R IGR +++R+ +IAAE +GVN K+ AF + IAG+L A ++G+ Sbjct: 201 RNLTRGTIGRKWMAIRDMDIAAEIIGVNPLTTKLSAFAVSSFFIGIAGALFFAVYLGAAE 260 Query: 230 VPKDYTFINSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQDV------------ASV 277 V + + S +L +++ GGLGSI G+ A L +L + L++V A + Sbjct: 261 VGEAFGIQKSFLILFMIIIGGLGSIFGSFAGAAFLVLLPVFLKNVLVGGLGWPSDLAAHI 320 Query: 278 RMIIYALALVLVMIFRPGGLLGTWEL 303 ++I ++ +I P GL W + Sbjct: 321 ELMIVGALIIGFLILEPHGLAQLWRV 346 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 358 Length adjustment: 28 Effective length of query: 290 Effective length of database: 330 Effective search space: 95700 Effective search space used: 95700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory