Align spermidine/putrescine ABC transporter, permease protein PotB (characterized)
to candidate WP_002719553.1 RSPH17029_RS05415 ABC transporter permease
Query= CharProtDB::CH_088337 (275 letters) >NCBI__GCF_000015985.1:WP_002719553.1 Length = 297 Score = 199 bits (507), Expect = 4e-56 Identities = 103/269 (38%), Positives = 168/269 (62%), Gaps = 12/269 (4%) Query: 9 LVLFVFLPNLMIIGTSFLTRDD----------ASFVKMVFTLDNYTR--LLDPLYFEVLL 56 L+L P L+++ SFL + ++ +++FT D ++ L + + Sbjct: 22 LLLAASGPLLVVLVYSFLVKGQYGGVIWTFSTEAWFEVLFTRDIFSDEVTLADAHLAIFW 81 Query: 57 HSLNMALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLST 116 S+ ++L+ T +G+P AWF+A P R L LFL+ +PFWTN LIR + + + Sbjct: 82 RSVKLSLMTTAITFAVGFPTAWFIATRPPNRRALWLFLITIPFWTNLLIRTFAINEVIRN 141 Query: 117 KGYLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARD 176 +G LN ++ G+I+ PI+I++T +AV+IG+ Y+ LP MV+PL+++I++ D LLEAA D Sbjct: 142 EGILNTLMIRAGLIERPIQILYTDTAVLIGMAYVYLPLMVLPLFAAIDRFDMRLLEAAYD 201 Query: 177 LGASKLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLN 236 L AS+ Q RII+PL PGI+AG +LV +P++G + ++GG KN++IGN I++QF Sbjct: 202 LYASRWQVLRRIILPLVKPGIVAGSILVFVPSLGAYVTPRVLGGGKNMMIGNFIELQFGQ 261 Query: 237 IRDWPFGAATSITLTIVMGLMLLVYWRAS 265 R+WP GAA S+ L ++ + LL+Y RA+ Sbjct: 262 GRNWPLGAALSMLLLAIVMVALLIYVRAA 290 Lambda K H 0.333 0.148 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 297 Length adjustment: 26 Effective length of query: 249 Effective length of database: 271 Effective search space: 67479 Effective search space used: 67479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory