Align Glutamate--putrescine ligase (EC 6.3.1.11) (characterized)
to candidate WP_002720539.1 RSPH17029_RS10185 glutamine synthetase family protein
Query= reanno::psRCH2:GFF4215 (457 letters) >NCBI__GCF_000015985.1:WP_002720539.1 Length = 445 Score = 298 bits (763), Expect = 2e-85 Identities = 171/446 (38%), Positives = 240/446 (53%), Gaps = 7/446 (1%) Query: 15 FLKEHPEVQYVDLLITDMNGVVRGKRIERASLHKVYEKGINLPASLFALDINGITVESSG 74 +L++HP+V+ + + D+NG RGKRI KV + G P S+ LDI G ++ S Sbjct: 4 WLRKHPQVRTIRVAAADLNGQARGKRIPARFADKVVKDGTRFPFSVLNLDIWGEDIDDSP 63 Query: 75 LGMDIGDSDRTCFPIPNTLCKEPWQKRPTAQLLMTMHERDGDPFFADPREVLRQVVSKFD 134 L + GD+D P PW + PTA L + M DG P+ DPR LR V+ ++ Sbjct: 64 LVFEQGDADGILRPTERGFMPMPWLEAPTALLPIWMFREDGRPYEGDPRHALRAVLDRYK 123 Query: 135 ELGLTICAAFELEFYLIDQENINGRP-QPPRSPISGKRPHSTQVYLIDDLDEYVDCLQDI 193 GLT A ELEF+LID +G+ Q P SP SGKR + + I LD + D+ Sbjct: 124 ARGLTPVVAVELEFFLIDD---SGKTLQVPPSPRSGKRRKAAEALSIRALDAFDIFFTDL 180 Query: 194 LEGAKEQGIPADAIVKESAPAQFEVNLHHVADPIKACDYAVLLKRLIKNIAYDHEMDTTF 253 + +E IPAD E+ QFEVNL H D ++A D A K L+K +A H +F Sbjct: 181 YDACEEMDIPADTATSETGLGQFEVNLMHCDDALRAADDAWFFKLLVKGLARRHGFAASF 240 Query: 254 MAKPYPGQAGNGLHVHISLLDKNGNNIFATENPLESAPLRHAIGGLQETMAASMAFLCPN 313 MAKPYP +G+GLH+H S+LD G N+F P +A +RHA+ G M S P+ Sbjct: 241 MAKPYPEYSGSGLHMHFSVLDAQGRNVFDNGGPTGTAMMRHAVAGCLNAMHDSTLVFAPH 300 Query: 314 VNSYRRFGAQFYVPNAPCWGMDNRTVALRVPTDSPDAVRVEHRVAGADANPYLMLASILA 373 NSY R + P A WG +NRT A+R+P +P A R+EHRVAG D NPYL++A+IL Sbjct: 301 ANSYDRLVPGMHAPTAISWGYENRTTAVRIPAGNPAARRIEHRVAGGDVNPYLLVATILG 360 Query: 374 GVHHGLTNKIEPDAPIEGNSY--EQVEQSLPTNLRDALRELDDSEIMARYISPDYIDIFV 431 G+ ++ EP I GN+Y E + Q +P + A++ ++S IM R + + I +V Sbjct: 361 AALTGIEDQEEPPQAIMGNAYALEDLPQ-IPPSWEAAIQSFENSAIMPRILPRELIRNYV 419 Query: 432 ACKESELAEFEHSISDLEYNWYLHTV 457 K EL + + YL TV Sbjct: 420 LTKRQELHYLAELSPEEQVELYLDTV 445 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 445 Length adjustment: 33 Effective length of query: 424 Effective length of database: 412 Effective search space: 174688 Effective search space used: 174688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory