Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; EC 1.1.1.138 (characterized)
to candidate WP_002720931.1 RSPH17029_RS12125 beta-ketoacyl-ACP reductase
Query= SwissProt::O93868 (262 letters) >NCBI__GCF_000015985.1:WP_002720931.1 Length = 240 Score = 135 bits (341), Expect = 6e-37 Identities = 86/252 (34%), Positives = 136/252 (53%), Gaps = 17/252 (6%) Query: 10 VNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAKDAVEVTEKVGKEFGVKTKAYQCD 69 ++K +VTGG+RGIG A + A+ AG VA Y +A K +E G+KT Y+ Sbjct: 1 MSKVALVTGGSRGIGAAISVALKNAGYTVAANYAGNDEAAR---KFTEETGIKT--YKWS 55 Query: 70 VSNTDIVTKTIQQIDADLGAISGLIANAGVSVVKPATELTHEDFKFVYDVNVFGVFNTCR 129 V++ D I Q++A+LG ++ L+ NAG++ ++T + +K V D N+ G+FN Sbjct: 56 VADYDACAAGIAQVEAELGPVAVLVNNAGITRDSMFHKMTRDQWKEVIDTNLSGLFNMTH 115 Query: 130 AVAKLW--LQKQQKGSIVVTSSMSSQIINQSSLNGSLTQVFYNSSKAACSNLVKGLAAEW 187 V W ++ ++ G I+ SS++ Q G Q Y+++KA K LA E Sbjct: 116 PV---WSGMRDRKFGRIINISSINGQ-------KGQAGQANYSAAKAGDLGFTKALAQEG 165 Query: 188 ASAGIRVNALSPGYVNTDQTAHMDKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATY 247 A AGI VNA+ PGY+ T+ + +K+R+ + IP R +PEE+ + L SD A + Sbjct: 166 ARAGITVNAICPGYIATEMVMAVPEKVRESIIAQIPTGRLGEPEEIARCVVFLASDDAGF 225 Query: 248 MTGGEYFIDGGQ 259 +TG +GGQ Sbjct: 226 VTGSTITANGGQ 237 Lambda K H 0.317 0.130 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 240 Length adjustment: 24 Effective length of query: 238 Effective length of database: 216 Effective search space: 51408 Effective search space used: 51408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory