Align Large component of TRAP-type D-gluconate transporter (characterized)
to candidate WP_002721138.1 RSPH17029_RS12970 TRAP transporter large permease subunit
Query= reanno::azobra:AZOBR_RS15920 (426 letters) >NCBI__GCF_000015985.1:WP_002721138.1 Length = 441 Score = 295 bits (755), Expect = 2e-84 Identities = 148/430 (34%), Positives = 253/430 (58%), Gaps = 14/430 (3%) Query: 1 MALAVFLSSLFGLMLLGMPIAFALMLTGVALMVHLDFFDAQLVAQNMLSGADNYPLMAVP 60 M A+ L LML GMPI+ AL LT + + + VA + +G + + +MA+P Sbjct: 1 MNAALIFGGLIALMLTGMPISIALGLTVLTFLFTMTAVPIDTVALKLFTGIEKFEIMAIP 60 Query: 61 FFILAGELMNAGGISQRIINLAVSLVGHIRGGLGYVTIGASVMLASLSGSAIADTAALAT 120 FFILAG + GG+++R+I A S+VGH GGLG + A + A++SGS+ A A+ + Sbjct: 61 FFILAGNFLTHGGVARRMIAFATSMVGHWHGGLGLGGVFACALFAAVSGSSPATVVAIGS 120 Query: 121 LLIPMMRDNGYPVPRSAGLIASGGIIAPIIPPSMPFIIFGVTTN--------------TS 166 +++P M G+P AG+I + G + +IPPS+ +++ V T+ S Sbjct: 121 VILPAMVAQGFPTRFGAGVITTSGALGILIPPSIVMVMYCVATSGMMVEGPDGTIVDAAS 180 Query: 167 ISGLFMAGIVPGLLMGAGLVITWMFVVRGMTVKLQPKASWGERRTALVEGVWALALPVII 226 + +F+AG++PG+++ L +T + PKASWGER A +W L L VI+ Sbjct: 181 VGEMFIAGVIPGIMLAGALALTTWYRAWKNDYPRLPKASWGERWQAFRRAIWGLLLIVIV 240 Query: 227 IGGLRGGIFTPTEAAVVAAVYSLVVALFVYRQVTLKDLVPLLVQAARTTSTVMFLCAAAL 286 +GG+ G FTPTEAA ++AVY+ V+A+FVY+ + LKD+ +L+ +A ++ ++++ A+ Sbjct: 241 MGGIYTGTFTPTEAAAMSAVYAFVIAVFVYKDMGLKDVPRVLLASANMSAMLLYIITNAV 300 Query: 287 VSSYMVTLADLPQQMNEMLAPLLHEPKLLMVAITLLLLAVGTVMDLTPTILVLGPVLTPL 346 + S+++T ++PQ + + + + ++A+ ++LLA G M+ + +L++ P+L P+ Sbjct: 301 LFSFLLTHENIPQALGQWMVDSGLTWWMFLIAVNIILLAAGNFMEPSSIVLIMAPILFPV 360 Query: 347 AAAAGIDPTYFGVMFVLTGTLGLIHPPVCTVLNVVCGVARISLESATRGIWPFLLTYLLL 406 A GIDP +FG+M ++ +G+ HPPV L V G+ ++ + T +WP+LLT L Sbjct: 361 AVRLGIDPVHFGIMIIVNMEVGMCHPPVGLNLYVASGITKMGITELTIAVWPWLLTMLAF 420 Query: 407 LCLLIAVPEI 416 L L+ VP+I Sbjct: 421 LLLVTYVPQI 430 Lambda K H 0.328 0.142 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 441 Length adjustment: 32 Effective length of query: 394 Effective length of database: 409 Effective search space: 161146 Effective search space used: 161146 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory