Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate WP_002721912.1 RSPH17029_RS00050 enoyl-CoA hydratase
Query= BRENDA::F4JML5 (301 letters) >NCBI__GCF_000015985.1:WP_002721912.1 Length = 258 Score = 153 bits (386), Expect = 5e-42 Identities = 91/244 (37%), Positives = 135/244 (55%), Gaps = 8/244 (3%) Query: 58 VNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCAGADLKERRTMSP 117 + L+RP NA+N +M+ L +A + ++ R +++ F AGAD+KE S Sbjct: 17 IRLNRPDALNALNSKMMSELADALGAADRNEKVRCIVLTGSEKA-FAAGADIKEMAEQSF 75 Query: 118 SEVHTYVNSLRYMFSFIEAL---SIPTIAAIEGAALGGGLEMALACDLRICGENAVFGLP 174 +V + S EA+ P +AA+ G ALGGG E+A+ CD I + A FG P Sbjct: 76 VDVF----GSDFFTSDSEAMLRVRKPIVAAVAGYALGGGCELAMMCDFIIAADTAKFGQP 131 Query: 175 ETGLAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVNICVTAGEAHEKAI 234 E L ++ G GGTQRL+R VG+S S ++ TGR +DA EA GLV+ V A E+A+ Sbjct: 132 EINLGVVAGLGGTQRLTRFVGKSKSMDMHLTGRFMDAAEAERCGLVSRVVPAKNLMEEAM 191 Query: 235 EMAQQINEKGPLAIKMAKKAIDEGIETNMASGLEVEEMCYQKLLNTQDRLEGLAAFAEKR 294 + A +I+EK L K+A++ ET + G+ E + L T+D+ EG+AAF EKR Sbjct: 192 KAASKISEKSLLTAMAVKEAVNRSYETTLREGVLFERRLFHALFATEDQKEGMAAFLEKR 251 Query: 295 KPLY 298 P + Sbjct: 252 TPQF 255 Lambda K H 0.318 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 258 Length adjustment: 25 Effective length of query: 276 Effective length of database: 233 Effective search space: 64308 Effective search space used: 64308 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory