Align Fructose import binding protein FrcB (characterized)
to candidate WP_002723116.1 RSPH17029_RS17240 substrate-binding domain-containing protein
Query= SwissProt::Q9F9B2 (341 letters) >NCBI__GCF_000015985.1:WP_002723116.1 Length = 310 Score = 108 bits (270), Expect = 2e-28 Identities = 85/299 (28%), Positives = 130/299 (43%), Gaps = 20/299 (6%) Query: 3 KTVLSAAFGALAMGVAFASPSQAAEVSACLITKTDTNPFFVKMKEGAAAKAKELGVTLKS 62 + L A + +G A + + L+ FF +M GA A + GV L Sbjct: 7 RRALGALLTSSLLGAAALPAFAQEQKTVALVQINQQALFFNEMNRGAQEAADKAGVKLVI 66 Query: 63 YAGKIDGDSESQVAAIETCIADGAKGILIAASDTQGIVPQVQKARDAGLLVIALDTPLEP 122 + + DS +Q +AIET I +G G+ + A D GI+P VQ+A DAG+ V+A+D L P Sbjct: 67 F--NANNDSAAQNSAIETYIQEGVDGLAVVAIDVNGIMPAVQQAADAGIPVVAIDAIL-P 123 Query: 123 LDAADATFATDNLLAGKLIGQWAAATLGDAAKEAKVAFLDLTPSQPSVDVLRDQGFMIGF 182 A DN AG + T+ + +K V L+ + +R GF Sbjct: 124 EGPQKAQIGVDNAKAGADLAAHYNETMAEPSKIGIVGALN-----SYIQNVRKDGFEQAL 178 Query: 183 GIDPKDPNKIGDEDDPRIVGHDITNGNEEGGRTAMENLLQKDPTINVVHTINEPAAAGAY 242 +D +VG ++ A ENL+ +P ++ ++ EPA GA Sbjct: 179 ------------DDKVTVVGTVDGQNIQDVALGAAENLITANPDLSAIYATGEPALMGAI 226 Query: 243 EALKSVGREKDVLIVSVDGGCPGVKNVAEGVIGATSQQYPLMMAALGIEAIKKFADTGE 301 + S G++ DV I D + + EG + A QQ P M A +EA+ AD GE Sbjct: 227 AGVASQGKQADVSIFGWDLTAQAIDAIDEGYLKAVIQQDPAAMGAAAVEALVTLADGGE 285 Lambda K H 0.313 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 310 Length adjustment: 28 Effective length of query: 313 Effective length of database: 282 Effective search space: 88266 Effective search space used: 88266 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory