Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_002904321.1 KVAR_RS13525 urea ABC transporter ATP-binding protein UrtD
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_000025465.1:WP_002904321.1 Length = 265 Score = 156 bits (394), Expect = 5e-43 Identities = 96/250 (38%), Positives = 147/250 (58%), Gaps = 10/250 (4%) Query: 3 LLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTL 62 +L+++ + F G A+ D++L + GEL +IGPNGAGKTTL +++TG P G Sbjct: 24 VLQLENINVSFDGFRALTDLSLAIGVGELRCVIGPNGAGKTTLMDVITGKTRPQSGKALY 83 Query: 63 DGHL-LNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPAF 121 D + L P IA G+GR FQ +F+ LTV +N+ +A + V+ S L A Sbjct: 84 DQSVDLTTLDPVAIARQGIGRKFQKPTVFEALTVAENLALAMKGD--KSVWAS---LRAR 138 Query: 122 YKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAAG 181 SE++ + E+L++ LDG+ A LS+GQ++ LEI L EP +L LDEPAAG Sbjct: 139 LSSEQDDRLN--EVLRLLRLDGERYRQAGLLSHGQKQFLEIGMLLVQEPHLLLLDEPAAG 196 Query: 182 MNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEIKT 241 M ET EL R + + ++M++EHDM V + +R+ VL G+++A+G+ E++ Sbjct: 197 MTDAETEYTAELFRTLAGQH--SLMVVEHDMGFVETIADRVTVLHQGQVLAEGSLREVQA 254 Query: 242 NKRVIEAYLG 251 N++VIE YLG Sbjct: 255 NEQVIEVYLG 264 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 265 Length adjustment: 24 Effective length of query: 230 Effective length of database: 241 Effective search space: 55430 Effective search space used: 55430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory