Align D-sorbitol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_003545418.1 RL_RS03395 SDR family oxidoreductase
Query= reanno::acidovorax_3H11:Ac3H11_2940 (244 letters) >NCBI__GCF_000009265.1:WP_003545418.1 Length = 241 Score = 332 bits (851), Expect = 4e-96 Identities = 158/238 (66%), Positives = 195/238 (81%) Query: 7 LQGQVAAITGAASGIGFASAQTMADAGARVVLIDRDEAALAKACATIGPNALPLVLDLLD 66 L G++AA+TGAASGIG AS + M AGA VVL+DRDE AL CA +G A+PLVL+LLD Sbjct: 4 LNGKIAAVTGAASGIGLASTEAMLAAGATVVLVDRDEKALETVCARLGERAIPLVLNLLD 63 Query: 67 ARQCASLLQRTLALAGQLDIFHANAGLYVGGDLVDADPDAIDRMLNLNVNVVMKNVHNVL 126 QCA LL+ L+ G+LDI HANAG Y+GGDL++ D D IDRMLNLNVNVV+KNV NV+ Sbjct: 64 PHQCAGLLEGILSKTGKLDILHANAGTYIGGDLMETDLDTIDRMLNLNVNVVIKNVRNVI 123 Query: 127 PHMIERGTGDIIVTSSLAAHFPTPWEPVYASSKWAVNCFVQTVRRQVFKHGIRVGSISPG 186 PHMIERGTGDI+VTSS+A H PWEPVY+SSKWA+ CFVQT+RRQ+ K GIRVGS+SPG Sbjct: 124 PHMIERGTGDIVVTSSVAGHSAIPWEPVYSSSKWAMTCFVQTMRRQLLKSGIRVGSVSPG 183 Query: 187 PVITSLLADWPAEKLAEAKASGSLIEAAEVAEVVLFMLTRPRGMTIRDVVMMPTNFDL 244 PVI++LLADWP E L +AK +G+LIE EVA+ ++FMLTRPR +TIRD+V++P+ FD+ Sbjct: 184 PVISALLADWPEENLRKAKEAGALIEPKEVADAIIFMLTRPRNVTIRDIVVLPSAFDI 241 Lambda K H 0.321 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 241 Length adjustment: 23 Effective length of query: 221 Effective length of database: 218 Effective search space: 48178 Effective search space used: 48178 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory