Align Fructose import binding protein FrcB (characterized)
to candidate WP_003550404.1 RL_RS34880 D-ribose ABC transporter substrate-binding protein
Query= SwissProt::Q9F9B2 (341 letters) >NCBI__GCF_000009265.1:WP_003550404.1 Length = 313 Score = 111 bits (278), Expect = 2e-29 Identities = 95/313 (30%), Positives = 146/313 (46%), Gaps = 24/313 (7%) Query: 2 KKTVLSAAFGALAMGVAFASPSQAAEVSACLITKTDTNPFFVKMKEGAAAKAKELGVTLK 61 ++ L+A GALA+G A P+ +A++ A +IT NPFF GA AKAKELG + Sbjct: 5 RRLTLAAFAGALALGTAL--PAFSADLIA-IITPAHDNPFFKAEAVGAEAKAKELGY--E 59 Query: 62 SYAGKIDGDSESQVAAIETCIADGAKGILIAASDTQGIVPQVQKARDAGLLVIALDTPLE 121 + D D+ Q I+T I GAK I++ + V V+KA+DAG+ +D + Sbjct: 60 TLLMTHDDDANKQSEMIDTAIGRGAKAIILDNAGADASVAAVKKAKDAGIPSFLIDREIN 119 Query: 122 PLDAADATFATDNLLAGKLIGQWAAATLGDAAKEAKVAFLDLTPSQPSVDV-LRDQGFMI 180 A A ++N +L Q +G+ K +++L + + +R QG+ Sbjct: 120 ATGVAVAQIVSNNYQGAQLGAQEFVKLMGE-----KGNYVELVGKESDTNAGIRSQGY-- 172 Query: 181 GFGIDPKDPNKIGDEDDPRIVGHDITNGNEEGGRTAMENLLQKDPTINVVHTINEPAAAG 240 + I D D + V N ++ + ME +LQ +P I V + N+ A G Sbjct: 173 --------HDVIDDYPDLKSVAKQSANWSQTEAYSKMETILQANPDIKGVISGNDTMAMG 224 Query: 241 AYEALKSVGREKDVLIVSVDGGCPGVKNVAEGVIGATSQQYPLMMAALGIEAIKKFADTG 300 A AL++ GR KDV++V DG ++ G I AT Q A L +E + Sbjct: 225 AIAALQAAGR-KDVIVVGFDGSNDVRDSIKSGGIKATVLQPAYAQAQLAVEQADAYIK-- 281 Query: 301 EKPTPTEGKDFVD 313 K TP E K +D Sbjct: 282 NKTTPKEEKQLMD 294 Lambda K H 0.313 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 313 Length adjustment: 28 Effective length of query: 313 Effective length of database: 285 Effective search space: 89205 Effective search space used: 89205 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory