GapMind for catabolism of small carbon sources

 

Protein WP_003553653.1 in Rhizobium leguminosarum WSM1325

Annotation: NCBI__GCF_000023185.1:WP_003553653.1

Length: 254 amino acids

Source: GCF_000023185.1 in NCBI

Candidate for 18 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-alanine catabolism Pf6N2E2_5405 med ABC transporter for D-Alanine, ATPase component (characterized) 70% 96% 342.4 ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component 69% 342.0
L-histidine catabolism aapP med ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 69% 98% 342 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-asparagine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 67% 96% 336.7 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-aspartate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 67% 96% 336.7 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-glutamate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 67% 96% 336.7 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-leucine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 67% 96% 336.7 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-proline catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 67% 96% 336.7 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-asparagine catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 67% 92% 325.9 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-aspartate catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 67% 92% 325.9 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-glutamate catabolism gltL med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 67% 92% 325.9 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-lysine catabolism hisP med Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 61% 96% 312 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-asparagine catabolism bgtA med ATPase (characterized, see rationale) 63% 98% 309.3 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-aspartate catabolism bgtA med ATPase (characterized, see rationale) 63% 98% 309.3 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-asparagine catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 58% 100% 281.2 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-aspartate catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 58% 100% 281.2 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-asparagine catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 56% 100% 264.6 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-aspartate catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 56% 100% 264.6 ABC transporter for D-Alanine, ATPase component 70% 342.4
L-tryptophan catabolism ecfA2 med Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 41% 77% 146.7 ABC transporter for D-Alanine, ATPase component 70% 342.4

Sequence Analysis Tools

View WP_003553653.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTSPSPAQGAETMITMERVEKWYGAFQALRDINISVRSGERIVLCGPSGSGKSTLIRCIN
HLETYEKGEIRVGGILLGNQAKTIDAIRREVGMVFQQFNLFPHLTVLQNCMLAPMKAAGV
GRAEAEERARGLLERVKILEQADKYPVQLSGGQQQRVAIARALCMRPKVMLFDEPTSALD
PEMVKEVLDTMIGLADEGMTMICVTHEMGFARQVADRVIFMASGAIVEEAPPAEFFTNPQ
HERTRKFLGEILRK

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory