Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate WP_003558186.1 RLEG_RS05890 3-oxoacyl-[acyl-carrier-protein] reductase
Query= uniprot:Q8EGC1 (252 letters) >NCBI__GCF_000023185.1:WP_003558186.1 Length = 245 Score = 139 bits (351), Expect = 4e-38 Identities = 88/254 (34%), Positives = 139/254 (54%), Gaps = 15/254 (5%) Query: 2 DLKDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQDKLERACADLGSSTEVQGYALD 61 DL + ++TG +GG+G +A + GA + L +KLE ADLG ++ + + Sbjct: 3 DLSGRKALVTGASGGIGEEIARLLHKQGAVVGLHGTRVEKLEALAADLGERVKI--FPAN 60 Query: 62 ITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVINVN 121 ++D ++V A D +++LVNNAGI RDG+ V RMS + + SVI VN Sbjct: 61 LSDRDEVKALGQKAEADLEGVDILVNNAGITRDGLFV---------RMSDEDWDSVIEVN 111 Query: 122 LTGTFLCGREAAAAMIESGQAGVIVNISSLAKA-GNVGQSNYAASKAGVAAMSVGWAKEL 180 LT TF RE M+ + G I+NI+S+ GN GQ+NY ASKAG+ + A+E+ Sbjct: 112 LTSTFRLTRELTHPMMRR-RYGRIINITSVVGVTGNPGQANYCASKAGMIGFTKSLAQEI 170 Query: 181 ARYNIRSAAVAPGVIATEMTAAMKPEALERLEKLVPVGRLGHAEEIASTVRFIIEND--Y 238 A N+ VAPG I + MT + + E + +P+ R+G E+AS V ++ ++ Y Sbjct: 171 ATRNVTVNCVAPGFIESAMTGKLNDKQKEAIMGAIPMKRMGTGGEVASAVAYLASSEAAY 230 Query: 239 VNGRVFEVDGGIRL 252 + G+ V+GG+ + Sbjct: 231 MTGQTLHVNGGMAM 244 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 245 Length adjustment: 24 Effective length of query: 228 Effective length of database: 221 Effective search space: 50388 Effective search space used: 50388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory