Align High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized)
to candidate WP_004266032.1 C665_RS01195 branched-chain amino acid ABC transporter permease
Query= SwissProt::P22729 (425 letters) >NCBI__GCF_000310185.1:WP_004266032.1 Length = 322 Score = 151 bits (381), Expect = 3e-41 Identities = 98/320 (30%), Positives = 163/320 (50%), Gaps = 20/320 (6%) Query: 92 FLVALLVLAVAWPFMVSRGTVDIATLTMIYIILGLGLNVVVGLSGLLVLGYGGFYAIGAY 151 F +A+L V +P + S V++ ++ I + L ++VG +GL+ LG+ ++ I AY Sbjct: 9 FKLAVLAGLVLFPAIGSSFYVELVAKILVMSIFAMSLALLVGFTGLVSLGHAAYFGIAAY 68 Query: 152 TFALLN-HYYGLGFWTCLPIAGLMAAAAGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLL 210 T AL+ Y W L + L A AA F +G VLR +G Y +VTL F ++ + Sbjct: 69 TVALIAPEYEAANLWFVLAASVLAAGAAAFFIGLFVLRTKGIYFIMVTLAFAQMA-YYIF 127 Query: 211 NNTEITGGPNGISQIPKPTLFGLEFSRTAREGGWDTFSNFFGLKYDPSDRVIFLYLVALL 270 ++T + +GI KP A GW F+ D + LY L Sbjct: 128 HDTALGRSSDGIYLNVKPD---------ASLFGWMPFN---------LDEPLHLYYFILA 169 Query: 271 LVVLSLFVINRLLRMPLGRAWEALREDEIACRSLGLSPRRIKLTAFTISAAFAGFAGTLF 330 +V ++ +LR P GR + +E +SLG + +R KL AFT++ A AG AG L+ Sbjct: 170 AMVAVFVLLAFVLRSPFGRVLAGIHSNEHRMKSLGYATQRYKLAAFTLAGALAGVAGFLY 229 Query: 331 AARQGFVSPESFTFAESAFVLAIVVLGGMGSQFAVILAAILLVVSRELMRDFNEYSMLML 390 A GFV+P+ ++ +S VL +V+LGG+GS + A + +E+ D+ ++ L++ Sbjct: 230 AVLFGFVTPDYLSWHQSGNVLLMVILGGLGSLAGAVAGAFAFIGLQEMFSDWTKHWQLLM 289 Query: 391 GGLMVLMMIWRPQGLLPMTR 410 G ++V +++ P GL + R Sbjct: 290 GLVIVAAVLFMPSGLAGLPR 309 Lambda K H 0.330 0.145 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 322 Length adjustment: 30 Effective length of query: 395 Effective length of database: 292 Effective search space: 115340 Effective search space used: 115340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory