Align Beta-ketothiolase BktB; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; EC 2.3.1.16; EC 2.3.1.9 (characterized)
to candidate WP_004298625.1 C665_RS01835 acetyl-CoA C-acyltransferase
Query= SwissProt::Q0KBP1 (394 letters) >NCBI__GCF_000310185.1:WP_004298625.1 Length = 393 Score = 436 bits (1121), Expect = e-127 Identities = 225/392 (57%), Positives = 289/392 (73%), Gaps = 2/392 (0%) Query: 3 REVVVVSGVRTAIGTFGGSLKDVAPAELGALVVREALARAQVSGDDVGHVVFGNVIQTEP 62 REVVV+S VR+A+G FGGSLKD+ P++LGA+V++EA+ARA V V G+ I T+ Sbjct: 4 REVVVLSAVRSAVGGFGGSLKDMEPSDLGAVVIKEAIARAGVDPKAVSFASVGHCIPTDS 63 Query: 63 RDMYLGRVAAVNGGVTINAPALTVNRLCGSGLQAIVSAAQTILLGDTDVAIGGGAESMSR 122 R Y+ RVA +N G+++++ A V+RLCGS QAIVS+AQ I+LGD D AIGGG E MSR Sbjct: 64 RYAYVSRVATINAGMSMDSVAFQVSRLCGSAQQAIVSSAQAIMLGDADFAIGGGVEVMSR 123 Query: 123 APYLAPAARWGARMGDAGLVDMMLGALHDPFHRIHMGVTAENVAKEYDISRAQQDEAALE 182 YL PA R GARMGD +D M+ L DPF HMG+TAEN+ ++ I+R +QD ALE Sbjct: 124 GTYLLPALRSGARMGDTKAIDSMVAVLTDPFGVGHMGITAENLCTKHGITREEQDAFALE 183 Query: 183 SHRRASAAIKAGYFKDQIVPVVSKGRKGDVTFDTDEHVRHDATIDDMTKLRPVFVKENGT 242 S +RA+AAI G FK QIVP+ + RKG V FDTDEH R T++ + K++P F K++G+ Sbjct: 184 SQKRAAAAIAEGRFKGQIVPITFETRKGTVVFDTDEHPRM-TTMEALGKMKPAF-KKDGS 241 Query: 243 VTAGNASGLNDAAAAVVMMERAEAERRGLKPLARLVSYGHAGVDPKAMGIGPVPATKIAL 302 VTAGNASG+NDAAA +V+ + A+A G KP+ARLVSY AGV MG GP+PATK+AL Sbjct: 242 VTAGNASGINDAAAFLVLADAAKAAAGGHKPIARLVSYAIAGVPNDVMGEGPIPATKLAL 301 Query: 303 ERAGLQVSDLDVIEANEAFAAQACAVTKALGLDPAKVNPNGSGISLGHPIGATGALITVK 362 +RAGL++ +DVIE+NEAFAAQ+ V + LGLD AKVNPNG ISLGHP+GATG++I K Sbjct: 302 QRAGLKLDQIDVIESNEAFAAQSITVNRGLGLDTAKVNPNGGAISLGHPVGATGSVIITK 361 Query: 363 ALHELNRVQGRYALVTMCIGGGQGIAAIFERI 394 LHEL R GRY + TMCIGGGQGI ++ER+ Sbjct: 362 LLHELIRTNGRYGVATMCIGGGQGITTVWERV 393 Lambda K H 0.318 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 393 Length adjustment: 31 Effective length of query: 363 Effective length of database: 362 Effective search space: 131406 Effective search space used: 131406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory