Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate WP_004299445.1 C665_RS02570 CoA transferase
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >NCBI__GCF_000310185.1:WP_004299445.1 Length = 399 Score = 220 bits (560), Expect = 7e-62 Identities = 148/408 (36%), Positives = 217/408 (53%), Gaps = 21/408 (5%) Query: 4 LSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTRAWGPPFLKDARGENTTEA 63 L+ ++V++L ++AGP+A +ILA+ GA+VIK+E P GD R W + T Sbjct: 8 LAGIKVVELGTLIAGPFAARILAEFGAEVIKIEAPDGGDPLRKWRKLY-------EGTSL 60 Query: 64 AYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKAINP 123 +YL A RNK+SVT++ P+G +VR L A++DI++ENF+ G L GL +++L INP Sbjct: 61 WWYLQA-RNKKSVTVNLKHPDGVEVVRRLVAEADIVVENFRPGVLDKLGLGWEALSKINP 119 Query: 124 QLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDILTG 183 L+ ++GFGQ+GP A++ G+ + + +GGL +TG P+ PVK G+++ D + Sbjct: 120 GLVMVRLSGFGQSGPMAQQPGFGAIGESMGGLRYVTGFPD----RPPVKTGISIGDSIAA 175 Query: 184 LYSTAAILAALAHRDHVGG-GQHIDMALLDVQVACLANQAMNYLTTGNAPKRLGNAHPNI 242 L+ L AL H++ GG GQ +D+AL + A + + + G +R GN P I Sbjct: 176 LWGALGALMALRHKEVNGGAGQVVDVALYEAVFAMMESLVPEFDVFGFVRERTGNIMPGI 235 Query: 243 VPYQDFPTADGDFILTVGNDGQ--FRKFAEVAGQPQWADDPRFATNKVRVANRAVLIPLI 300 P T DG I T+G +G FR+ G+ A+D A N R A R L LI Sbjct: 236 TPSNTHTTRDGRHI-TIGANGDAIFRRLMRAMGRDDLAEDATLADNAGRDARREELYALI 294 Query: 301 RQATVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARGL--AMELPHLLAGKVPQV 358 A + L A VP I +A +FADPQ AR + ++LP ++P V Sbjct: 295 DAWVAQHDEAAVLATLAAAEVPASRIYSVADMFADPQFLAREMLHTVKLPDGRDCRMPGV 354 Query: 359 ASPIRLSETPVEYRNAPPLLGEHTLEVLQRVLGLDEAAVMAFREAGVL 406 +LS TP P LG HT VL LG DEA + A R AG + Sbjct: 355 VP--KLSGTPGGSEWIGPALGAHTDAVLAG-LGYDEARIAALRAAGAI 399 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 399 Length adjustment: 31 Effective length of query: 375 Effective length of database: 368 Effective search space: 138000 Effective search space used: 138000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory