Align subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized)
to candidate WP_004300924.1 C665_RS04210 acetyl-CoA C-acyltransferase
Query= metacyc::MONOMER-3207 (400 letters) >NCBI__GCF_000310185.1:WP_004300924.1 Length = 427 Score = 255 bits (651), Expect = 2e-72 Identities = 165/431 (38%), Positives = 239/431 (55%), Gaps = 39/431 (9%) Query: 2 RDVFICDAIRTPIGRFGGALAGVRADDLAAVPLKALIEPNPAVQWDQVDEVFFGCANQAG 61 + ++I D RTP + A A DLA AL+ P DQ+DEV GCA+ + Sbjct: 3 KPIYIVDGARTPFLKAKNAPGPFTASDLATAAGSALLMRQPFAP-DQLDEVILGCASPSA 61 Query: 62 EDNRNVARMALLLAGLPESIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESMS 121 D N+ R+ L G +PG T+ R CASGM AI +A + G +L +AGGV+++S Sbjct: 62 -DEVNIGRVVALRLGCGNKVPGWTVMRNCASGMQAIDSAIANLQCGRSQLVLAGGVDALS 120 Query: 122 RAPFVMGK-----------AESGYSRNMKLEDTTIGWRFINPLMKSQYGVDS------MP 164 AP + + A S R L +G + P++ G+ M Sbjct: 121 HAPLLFSEKMVRWLAGWYAARSTGDRLAMLRTFRLG--HLAPVIGIMKGLTDPIVGQLMG 178 Query: 165 ETADNVADDYQVSRADQDAFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKGETIVERDEH 224 +T +N+A + ++R D DAFA+ S ++ A Q AG +AEEIVP + + G+ + D+ Sbjct: 179 QTGENLAWKFGITREDMDAFAVESHRRVCAGQDAGHYAEEIVP--LIDRDGQ-VYAADDG 235 Query: 225 LRPETTLEALTKLKPV-NGPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRARVLG 283 +R ++++ L KLKP + VT GN+S + DGAA L+LAS EAV++HGL P R++ Sbjct: 236 VRRDSSMANLAKLKPFFDRKYGRVTPGNSSQITDGAAWLVLASQEAVERHGLQPLGRIVD 295 Query: 284 MASGGVAPRVMGIGPVPAVRKLTERLGVAVSDFDVIELNEAFASQGLAVLR--------- 334 G+AP MG+GPV A + +R G+A D D ELNEAFA+Q +A LR Sbjct: 296 SQWAGLAPDQMGLGPVHATMPILQRHGLAPDDLDAWELNEAFAAQVIACLRAFADDDYCR 355 Query: 335 -ELGV----ADDAPQVNPNGGAIALGHPLGMSGARLVLTALHQLEKSGGRKGLATMCVGV 389 GV A DA ++N +GGA+ALGHP+G SGAR+VL L L + GG +GLA++C+G Sbjct: 356 THFGVDAPGAPDAARLNVDGGAVALGHPVGASGARIVLHLLEVLRRKGGGRGLASICIGG 415 Query: 390 GQGLALAIERV 400 GQG A+ +E V Sbjct: 416 GQGGAMLVETV 426 Lambda K H 0.318 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 30 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 427 Length adjustment: 31 Effective length of query: 369 Effective length of database: 396 Effective search space: 146124 Effective search space used: 146124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_004300924.1 C665_RS04210 (acetyl-CoA C-acyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.22252.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-131 423.1 0.0 5.6e-131 422.9 0.0 1.0 1 lcl|NCBI__GCF_000310185.1:WP_004300924.1 C665_RS04210 acetyl-CoA C-acyltr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000310185.1:WP_004300924.1 C665_RS04210 acetyl-CoA C-acyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 422.9 0.0 5.6e-131 5.6e-131 1 385 [] 7 424 .. 7 424 .. 0.97 Alignments for each domain: == domain 1 score: 422.9 bits; conditional E-value: 5.6e-131 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaag 69 ivd++Rtp+ k++++ ++a+dL++a+ ++ll+r+ + p+++devilG++ ++++++ni+R +al+ g lcl|NCBI__GCF_000310185.1:WP_004300924.1 7 IVDGARTPFLKAKNAPGPFTASDLATAAGSALLMRQPFAPDQLDEVILGCASPSADEVNIGRVVALRLG 75 8******************************************************************** PP TIGR01930 70 lpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakled 138 ++++vp++tv r CaSg+qA+ +a +++++G+ ++v+aGGv+ +S++p+l ++++ r+ + +a++ lcl|NCBI__GCF_000310185.1:WP_004300924.1 76 CGNKVPGWTVMRNCASGMQAIDSAIANLQCGRSQLVLAGGVDALSHAPLLFSEKMVRWLAGWYAARSTG 144 *******************************************************99999888777777 PP TIGR01930 139 qllkdl....................vktklsmgetAenlakkygisReeqDeyalrShqkaakAieeg 187 +l l + + mg+t enla+k+gi+Re++D++a++Sh++ + +++g lcl|NCBI__GCF_000310185.1:WP_004300924.1 145 DRLAMLrtfrlghlapvigimkgltdPIVGQLMGQTGENLAWKFGITREDMDAFAVESHRRVCAGQDAG 213 666666788****************988999************************************** PP TIGR01930 188 kfkdeivpvevkgkkkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmsee 256 + ++eivp+ ++ +v++ D+g+r+++++++LakLkp f++k g+ vt gNssq++DGAa l+l+s+e lcl|NCBI__GCF_000310185.1:WP_004300924.1 214 HYAEEIVPLIDRD-GQVYAADDGVRRDSSMANLAKLKPFFDRKYGR-VTPGNSSQITDGAAWLVLASQE 280 ********86665.899****************************6.********************** PP TIGR01930 257 vakelgltplarivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelg 325 +++++gl+pl+riv+ ++ag+ p++mglgpv+A+ +L+++gl +d+d++E+nEAFAaqv+a+ ++++ lcl|NCBI__GCF_000310185.1:WP_004300924.1 281 AVERHGLQPLGRIVDSQWAGLAPDQMGLGPVHATMPILQRHGLAPDDLDAWELNEAFAAQVIACLRAFA 349 ********************************************************************* PP TIGR01930 326 s...............ldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqG 379 + d +++Nv GGA+AlGHP+GasGarivl+ll+ L+++g+ +Gla++C+ggGqG lcl|NCBI__GCF_000310185.1:WP_004300924.1 350 DddycrthfgvdapgaPDAARLNVDGGAVALGHPVGASGARIVLHLLEVLRRKGGGRGLASICIGGGQG 418 ************99864499************************************************* PP TIGR01930 380 aAvile 385 A+++e lcl|NCBI__GCF_000310185.1:WP_004300924.1 419 GAMLVE 424 ***997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (427 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.81 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory