Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_004302726.1 C665_RS05895 3-oxoacyl-ACP reductase FabG
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_000310185.1:WP_004302726.1 Length = 249 Score = 144 bits (363), Expect = 2e-39 Identities = 102/247 (41%), Positives = 139/247 (56%), Gaps = 13/247 (5%) Query: 14 FRLDGRHALVTGGAQGIGFEIARGLAQAGARV----TIADLNPDVGEGAARE-LDGTFER 68 F L+G+ ALVTG ++GIG +A L + GA V T D+G+ A + G Sbjct: 3 FSLEGQVALVTGASRGIGRAVALELGRLGATVVGTATSESGAADIGKALADAGIQGAGMA 62 Query: 69 LNVTDADA----VADLARRLPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVFWC 124 L+VTDA A V ++ +R V +LVNNAGI R+ A D++W AV++ NL VF Sbjct: 63 LDVTDAAACEALVGEVEKRFGAVGILVNNAGITRDNLAMRMKDEEWDAVVNTNLRAVFRM 122 Query: 125 CREFGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGVR 184 + R M+ G I++ S+ + S+ QA Y A+KA V +TR+LA E SR + Sbjct: 123 SKLVMRGMMKARHGRIINITSV--VASSGNPGQANYAAAKAGVAGMTRALARELGSRNIT 180 Query: 185 VNAVAPGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFVTGH 244 VN VAPG+ T +TR E R+ L LGRL P EIA AV +LAS AA++VTG Sbjct: 181 VNCVAPGFIDTDMTRALPEAA--RDALLGNIALGRLGRPEEIAGAVAFLASPAAAYVTGT 238 Query: 245 TLVVDGG 251 TL V+GG Sbjct: 239 TLHVNGG 245 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 249 Length adjustment: 24 Effective length of query: 231 Effective length of database: 225 Effective search space: 51975 Effective search space used: 51975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory