Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate WP_004303332.1 C665_RS06445 ABC transporter substrate-binding protein
Query= reanno::pseudo3_N2E3:AO353_03055 (258 letters) >NCBI__GCF_000310185.1:WP_004303332.1 Length = 263 Score = 243 bits (620), Expect = 3e-69 Identities = 133/262 (50%), Positives = 163/262 (62%), Gaps = 5/262 (1%) Query: 1 MKKLVLLGALALSVLSLPTFADEKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEE 60 MKK LL A+ D +++ E AYPPF A DGS+ GFD DIGNALCEE Sbjct: 1 MKKYALLCAVLTLHAGAGFAKDWNEIRLASEGAYPPFNLIAADGSLQGFDIDIGNALCEE 60 Query: 61 MKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITDDRKKSVDFTNKYYNTPARLVMKAGT 120 MK KC WV+QE+DG+IPAL RK DAI++SMSITD+RK VDFT KYY +P L+ K G+ Sbjct: 61 MKAKCTWVKQEWDGMIPALVSRKFDAIIASMSITDERKAKVDFTEKYYASPLALIAKKGS 120 Query: 121 QVSDNLAELKGKKIGVQRGSIHNRFAEEVLKPLGAEIKPYGSQNEIYLDVAAGRLDGTVA 180 + +L L GKK+GVQRG++ + FA + G +I Y Q+E YLD+ AGRLD + Sbjct: 121 TLRPDLPSLAGKKVGVQRGTVSDNFATKYWDGKGMQIIRYAKQDEAYLDLRAGRLDAAFS 180 Query: 181 DATLLDDGFLKTDSGKGFAFVGPAF----TDEK-YFGDGIGIAVRKGDKAELDKINAAIV 235 D GFL G G+ G DEK G+GIGIAVRK DK +K+N A+ Sbjct: 181 DYLEAYGGFLTKPEGAGYDVAGERLFGKDADEKAVIGEGIGIAVRKRDKELTEKLNQALG 240 Query: 236 AIRANGKYKQIQDKYFNFDIYG 257 AIRANGKY IQ KYF DIYG Sbjct: 241 AIRANGKYDAIQKKYFPMDIYG 262 Lambda K H 0.318 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 263 Length adjustment: 25 Effective length of query: 233 Effective length of database: 238 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory