Align Histidine transport system permease protein HisM (characterized)
to candidate WP_004303334.1 C665_RS06450 histidine/lysine/arginine/ornithine ABC transporter permease HisQ
Query= SwissProt::P0A2I7 (235 letters) >NCBI__GCF_000310185.1:WP_004303334.1 Length = 230 Score = 106 bits (264), Expect = 4e-28 Identities = 83/231 (35%), Positives = 119/231 (51%), Gaps = 20/231 (8%) Query: 2 IEIIQEYWKSLLWTDGYRFTGVAITLWLLISSVVMGGLLAVILAVGRVSSNKFIRFPIWL 61 ++ + EY SLL G +TL + + SV++ +I A ++S +R L Sbjct: 1 MDALIEYSPSLL-------AGAWVTLKVALMSVLLALATGLIGAACKLSGFLPLRLWTML 53 Query: 62 FTYIFRGTP-LYVQLLVFYSGMYTLEIVK---GTDLLNAF-FRSGLNCTVLALTLNTCAY 116 +T + RG P L + LLVFY G L V G D + F +G VL + L AY Sbjct: 54 YTTVMRGVPDLVMMLLVFYGGQLLLNAVIDYFGWDFIEIDPFVAG----VLTIGLIFGAY 109 Query: 117 TTEIFAGAIRSVPHGEIEAARAYGFSSFKMYRCIILPSALRIALPAYSNEVILMLHSTAL 176 TE F GA +V G++EA RAYG S+ +++R I+ P LR ALP N +++L STA+ Sbjct: 110 FTETFRGAFLAVSAGQLEAGRAYGMSALQVFRRILFPQMLRFALPGIGNNWLVLLKSTAI 169 Query: 177 AFTATVPDLLKIARDINSATYQPFTAFGIAAVLYL----LISYVLISLFRR 223 + D+ +IA +T+QPFT + VLYL L SY L L RR Sbjct: 170 VSMIGLSDMTRIADQAGRSTHQPFTFYLAVCVLYLAMTALSSYGLGVLTRR 220 Lambda K H 0.330 0.141 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 230 Length adjustment: 23 Effective length of query: 212 Effective length of database: 207 Effective search space: 43884 Effective search space used: 43884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory