Align C4-dicarboxylate TRAP transporter large permease protein DctM (characterized)
to candidate WP_004303790.1 C665_RS06945 TRAP transporter large permease
Query= SwissProt::Q9HU16 (427 letters) >NCBI__GCF_000310185.1:WP_004303790.1 Length = 430 Score = 264 bits (674), Expect = 5e-75 Identities = 162/428 (37%), Positives = 248/428 (57%), Gaps = 11/428 (2%) Query: 1 MTILFLFLLLFLLM-FIGVPIA---VSLGLSGALTILLFSPDSVRSLA-IKLFETSEHYT 55 MT+ L LL L++ F+ VP+A +S+ L G ++ + D RSL + + E Y Sbjct: 1 MTVGLLSLLAVLVLAFLRVPLAFALLSVSLGGIGVVMGW--DVARSLVPMTISEAVFSYE 58 Query: 56 LLAIPFFLLSGAFMTTGGVARRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATV 115 L +P F+L G + G++ L ANA +G +RGGLA++ ++ C F+A+ GSS AT Sbjct: 59 LAVVPMFILMGNILARTGISDDLFRAANAFLGPVRGGLALSTMVTCAGFSAVCGSSLATA 118 Query: 116 AAVGSIAIAGMVRSGYPQAFGAGIVCNAGTLGILIPPSIVMVVYAAATETSVGKLFIAGV 175 A + +A M R GY A + + GTLGILIPPSI++++Y T+T++G LF+AGV Sbjct: 119 ATMSKVAYPSMKRYGYSDALASATIAAGGTLGILIPPSIILMIYGILTQTNIGHLFVAGV 178 Query: 176 VPGLLLGLILMVVIYIVARV--KKLPAMPRVSLREWLASARKALWGLLLMVIILGGIYSG 233 VPGLL L+ ++VIY VAR+ + P R ++ E L + R LL V+I+GG+Y Sbjct: 179 VPGLLGLLMYLLVIYAVARISPQDAPRGERTTMAEKLHALRGVWPFTLLFVLIIGGLYGK 238 Query: 234 AFTPTEAAAVAAVYSAFVALFVYRDMRLSECPKVLLESGKLTIMLMFIIANAMLFAHVLT 293 FT TEAA + A A + V M + + +E+ ++ML ++ A+LFA +++ Sbjct: 239 LFTATEAAGMGAGL-ALILSMVQGRMSWQDFRHIFIETATTSVMLYSVLFGALLFAKLIS 297 Query: 294 TEQIPQSIASWVTELGLSPWMFLLVVNIVLLIAGNFMEPSAIILILAPIFFPIAMELGID 353 + + I + GL PW ++ + +V L+ G M+ AIILI P+F PI + G D Sbjct: 298 FSGLGEGILELFNQAGLGPWGTIVAILVVFLLLGCVMDSLAIILICVPLFVPILLAHGFD 357 Query: 354 PIHLGIIMVVNMEIGLITPPVGLNLFVTSA-VTGMPLGATIRAALPWLMILLVFLIIVTY 412 + GII+VV EI LITPP+G+N+FV A + + LGA R P++ I LV L ++ Sbjct: 358 LVWFGIIVVVVTEIALITPPIGMNVFVLKATLPHVRLGAIFRGLTPFIAIDLVRLALLVI 417 Query: 413 IPAVSLAL 420 P++SLAL Sbjct: 418 FPSISLAL 425 Lambda K H 0.330 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 430 Length adjustment: 32 Effective length of query: 395 Effective length of database: 398 Effective search space: 157210 Effective search space used: 157210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory