Align crotonase (EC 4.2.1.150) (characterized)
to candidate WP_004308191.1 C665_RS10355 enoyl-CoA hydratase
Query= metacyc::MONOMER-13469 (259 letters) >NCBI__GCF_000310185.1:WP_004308191.1 Length = 269 Score = 160 bits (404), Expect = 3e-44 Identities = 96/256 (37%), Positives = 143/256 (55%), Gaps = 10/256 (3%) Query: 9 EKDGNVASITLNRPKALNALNAATLKEIDAAINDIAEDDNVYAVIITGSGKAFVAGADIA 68 E G V ++TLNRP+ NAL+ L+ + AA+++IA D+ V V+I G GKAF AG D+ Sbjct: 19 EDAGGVTTLTLNRPQQFNALSFEMLEALIAAVDEIARDETVRVVVIAGEGKAFCAGHDLK 78 Query: 69 EMKDLTAVE--GRKFSVLGNKIFRKLENLEKPVIAAINGFALGGGCELSLSCDIRIASSK 126 EM+ +E R F + G + KL L +PVIA ++ A GC+L CD+ +A+ Sbjct: 79 EMRGNHTLEFQQRLFRLCG-RFMMKLTELPQPVIARVHSIATAAGCQLVSMCDLAVAAEH 137 Query: 127 AKFGQPEVGLGI---TPGFGGTQRLARAIGVGMAKELIYTGKVINAEEALRIGLVNKVVE 183 A+F + +G+ TPG G L+R +G A E++ TG I+A EA R GL+N+VV Sbjct: 138 ARFAVSGINVGLFCATPGVG----LSRNMGRKEAFEMLVTGDFIDAREAQRRGLINRVVP 193 Query: 184 PDKLLEEAKALVDAIIVNAPIAVRMCKAAINQGLQCDIDTGVAYEAEVFGECFATEDRVE 243 D+L EE L +I+ +P+A+RM K + L+ +D +E ED E Sbjct: 194 ADQLDEEVGRLAASILAKSPVAIRMGKQMFYKQLEMGLDAAYQLASETMACNAMCEDAAE 253 Query: 244 GMTAFVEKRDKAFKNK 259 G+ AF+ KR FK + Sbjct: 254 GIDAFIAKRKPEFKGR 269 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 269 Length adjustment: 25 Effective length of query: 234 Effective length of database: 244 Effective search space: 57096 Effective search space used: 57096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory