Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_004310392.1 C665_RS11645 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A165KER0 (358 letters) >NCBI__GCF_000310185.1:WP_004310392.1 Length = 314 Score = 134 bits (336), Expect = 4e-36 Identities = 103/331 (31%), Positives = 163/331 (49%), Gaps = 25/331 (7%) Query: 22 LQSFGNAWVRIADLALLYVLLALGLNIVVGYAGLLDLGYVAFYAVGAYLFALMASPHLAD 81 L N V +A L +Y LLALGLNI G+ GL + G F+AVGAY A++ S Sbjct: 3 LLGLANYAVFMAILIGIYALLALGLNIQWGFTGLFNAGIAGFFAVGAYTSAILTSLPATG 62 Query: 82 NFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLKLRGDYLAIVTLGFGEIIRI 141 + G W+ AA L A+ +G L+ R DYLAI T+G EIIR+ Sbjct: 63 RLGGYELPLVVG-----WLAAMAAAALIAW---PIGKICLRFRSDYLAIATIGIAEIIRL 114 Query: 142 FLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLEVFGFDINSVTLYYYLFLVLVVVSV 201 + LT G +G+ + + FG DL + S Y + LV+++ Sbjct: 115 VIRTEGW---LTGGVRGVTGVP--RPFG-DLDY--------MPSQIAYLAIVATLVLIAY 160 Query: 202 IICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNMKLLAFGMGASFGGVSGAMFGAFQGF 261 ++ R + GR AIR++E+AA AMG +L AF G++ G++GA+F F Sbjct: 161 LLVERQVKAPWGRMMRAIRDNELAAAAMGKQVEARRLQAFVFGSALMGLAGALFVHFNRS 220 Query: 262 VSPESFS-LMESVMIVAMVVLGGIGHIPGVILGAVLLSALPEVLRYVAGPLQAMTDGRLD 320 ++PE+ ++ + +I M++LGG G+ G ILGA ++ + V + L T+ + Sbjct: 221 ITPEAIDPMIATFLIWIMLILGGSGNNRGAILGAAVIWIIWSVSELLTDRLP--TEVAVQ 278 Query: 321 SAILRQLLIALAMIIIMLLRPRGLWPSPEHG 351 + R +I L + +++ RP G+ P + G Sbjct: 279 AKYARVFIIGLTLQLVLRFRPEGILPERQAG 309 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 314 Length adjustment: 28 Effective length of query: 330 Effective length of database: 286 Effective search space: 94380 Effective search space used: 94380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory