Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate WP_004312069.1 C665_RS12450 acyl-CoA dehydrogenase
Query= BRENDA::Q3JP94 (395 letters) >NCBI__GCF_000310185.1:WP_004312069.1 Length = 377 Score = 210 bits (535), Expect = 5e-59 Identities = 129/375 (34%), Positives = 202/375 (53%), Gaps = 2/375 (0%) Query: 18 LADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQYGGPGL 77 L ++ ++RD+ A+AQ +LAP E R+ T E+ E+G LG +PE++GG G+ Sbjct: 3 LTQEQELIRDSMRAFAQERLAPFAAEWDRNHTFPREALNELAELGALGMVVPEEWGGAGM 62 Query: 78 DYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLPKLATGEWIGCFG 137 DY+S L E+ D +++SVQ+SL + FGSDAQKE +L LA GE +GCF Sbjct: 63 DYMSLVLTLEEIAAGDGATSTIVSVQNSLPCGILNRFGSDAQKEAWLKPLARGEKLGCFC 122 Query: 138 LTEPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLDE-DGRDEIRGF 196 LTEP+ GSD ++ T A + + L+G K +IT ADV +V+A D+ G+ I F Sbjct: 123 LTEPHVGSDASAIRTSAVRDGNEWVLNGVKQFITTGKHADVAIVFAVTDKAAGKKGITCF 182 Query: 197 ILEKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENIL-PHVKGLRGPFTCLNSARY 255 ++ G I K+G +AS T +I+ ++ +P ++++ +G R + L + R Sbjct: 183 LVPANAPGYQVGRIEEKMGQKASDTTQILFEDCRIPADSVVGKEGEGYRIALSNLEAGRI 242 Query: 256 GIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGVLRLGR 315 GIA LG A + A +Y +R+ FG+P+ +Q + +LADM T++ Q V Sbjct: 243 GIAAQCLGMARAALEAAVKYAQERESFGKPIFEHQAVNFRLADMATQLEAARQLVWHAAS 302 Query: 316 MKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVNTYEG 375 +KD G ++ S+ K + A + A + GG G +F V R ++ V YEG Sbjct: 303 LKDAGRPCLKEASMAKLFASEMAERVCSDAIQVHGGYGYVTDFPVERIYRDVRVCQIYEG 362 Query: 376 THDIHALILGRAQTG 390 DI L++GRA G Sbjct: 363 ASDIQKLVIGRALAG 377 Lambda K H 0.320 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 377 Length adjustment: 30 Effective length of query: 365 Effective length of database: 347 Effective search space: 126655 Effective search space used: 126655 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory