Align 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 (characterized)
to candidate WP_004314496.1 C665_RS13470 4-aminobutyrate--2-oxoglutarate transaminase
Query= SwissProt::P22256 (426 letters) >NCBI__GCF_000310185.1:WP_004314496.1 Length = 433 Score = 516 bits (1330), Expect = e-151 Identities = 249/421 (59%), Positives = 314/421 (74%) Query: 4 NKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVV 63 N + M RR+ A+PRGVGQ HP+FA +A N VWDVEGR ++DF GIAV+NTGH HP+VV Sbjct: 12 NADFMARRAAALPRGVGQAHPLFATKALNAEVWDVEGRRFIDFVAGIAVVNTGHCHPRVV 71 Query: 64 AAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIAR 123 AA +AQL SHTCFQV+AY+ YL L E +N PGD AKKT+LV+TG+EAVENAVKIAR Sbjct: 72 AAAQAQLTHFSHTCFQVVAYDGYLRLAERLNALAPGDAAKKTMLVSTGAEAVENAVKIAR 131 Query: 124 AATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISEDDA 183 A T R G IAF+GA+HGRT L LTGKV+PY G+G PG +Y A YPC LHGIS +DA Sbjct: 132 AFTGRPGVIAFNGAFHGRTLLALGLTGKVDPYKLGVGPFPGEIYHAPYPCALHGISVEDA 191 Query: 184 IASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQS 243 I I +FKND +AA ++EPVQGEGG+Y + F+QRLRAL D+HGI+LIADE+QS Sbjct: 192 IHGIELLFKNDIEARRVAAFIVEPVQGEGGYYPAPAEFLQRLRALADKHGILLIADEIQS 251 Query: 244 GAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAGNPI 303 G GR G +FA+E GV PD+ T AK + GGFP+A V GRAEVMDA+APGGLG TYAG P+ Sbjct: 252 GIGRCGKMFAVEHSGVMPDIITLAKGLGGGFPVAAVVGRAEVMDALAPGGLGSTYAGAPM 311 Query: 304 ACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFEDG 363 AC AAL VL V E+E L ++A +G+ ++ L +A +H IGDVRGLGAM+A+E F DG Sbjct: 312 ACAAALAVLDVMEEEKLCERALAIGEHMQRRLRDLAVRHKCIGDVRGLGAMVAVEFFHDG 371 Query: 364 DHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQCFDE 423 DH +P ++ ++A A +GL+LLSCG Y NVLR++VPLTIE A + +GL++++ D Sbjct: 372 DHARPAPEIAKAVIAAALQRGLLLLSCGSYGNVLRLMVPLTIEQAVLDEGLDLLAAAMDA 431 Query: 424 A 424 A Sbjct: 432 A 432 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 617 Number of extensions: 22 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 433 Length adjustment: 32 Effective length of query: 394 Effective length of database: 401 Effective search space: 157994 Effective search space used: 157994 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_004314496.1 C665_RS13470 (4-aminobutyrate--2-oxoglutarate transaminase)
to HMM TIGR00700 (gabT: 4-aminobutyrate transaminase (EC 2.6.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00700.hmm # target sequence database: /tmp/gapView.26044.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00700 [M=420] Accession: TIGR00700 Description: GABAtrnsam: 4-aminobutyrate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-170 553.2 3.9 1.8e-170 553.0 3.9 1.0 1 lcl|NCBI__GCF_000310185.1:WP_004314496.1 C665_RS13470 4-aminobutyrate--2- Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000310185.1:WP_004314496.1 C665_RS13470 4-aminobutyrate--2-oxoglutarate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 553.0 3.9 1.8e-170 1.8e-170 2 418 .. 18 429 .. 17 431 .. 0.99 Alignments for each domain: == domain 1 score: 553.0 bits; conditional E-value: 1.8e-170 TIGR00700 2 rraaavskGvgvtlrvlaakaegaelkdvdGnrlidlaagiavlnvGhshPkvveavkrqveelthtaf 70 rraaa ++Gvg + + +a+ka +ae+ dv+G+r+id+ agiav+n+Gh hP+vv+a + q+ ++ ht+f lcl|NCBI__GCF_000310185.1:WP_004314496.1 18 RRAAALPRGVGQAHPLFATKALNAEVWDVEGRRFIDFVAGIAVVNTGHCHPRVVAAAQAQLTHFSHTCF 86 8******************************************************************** PP TIGR00700 71 qvvpyesyvelaeklnaiaPgsgekkavllnsGaeavenavkiarkytgrpgvvafsrgfhGrtnltma 139 qvv y++y+ lae+lna+aPg kk++l+++Gaeavenavkiar++tgrpgv+af+++fhGrt l++ lcl|NCBI__GCF_000310185.1:WP_004314496.1 87 QVVAYDGYLRLAERLNALAPGDAAKKTMLVSTGAEAVENAVKIARAFTGRPGVIAFNGAFHGRTLLALG 155 ********************************************************************* PP TIGR00700 140 ltakvkPykiGfGPfapevyraPlpydyrdialdkqeslddelaaiealfvadveaeqvaavvlePvqG 208 lt+kv Pyk+G GPf++e+y+aP+p +++i++ +d ++ ie lf+ d+ea++vaa ++ePvqG lcl|NCBI__GCF_000310185.1:WP_004314496.1 156 LTGKVDPYKLGVGPFPGEIYHAPYPCALHGISV------EDAIHGIELLFKNDIEARRVAAFIVEPVQG 218 ******************************998......567779************************ PP TIGR00700 209 eGGfivpakelvaavaslckehgivliadevqtGfartGklfaieheddkPdlitvaksladGlPlsgv 277 eGG+ ++ e+++ ++ l ++hgi+liade+q+G r Gk+fa+eh ++ Pd+it+ak+l +G+P+++v lcl|NCBI__GCF_000310185.1:WP_004314496.1 219 EGGYYPAPAEFLQRLRALADKHGILLIADEIQSGIGRCGKMFAVEHSGVMPDIITLAKGLGGGFPVAAV 287 ********************************************************************* PP TIGR00700 278 vGraeildapapGglGGtyaGnPlavaaalavldiieeeglieraeqigklvkdklielkeevpaigdv 346 vGrae++da apGglG tyaG+P+a+aaalavld++eee l+era ig+ ++ +l +l + igdv lcl|NCBI__GCF_000310185.1:WP_004314496.1 288 VGRAEVMDALAPGGLGSTYAGAPMACAAALAVLDVMEEEKLCERALAIGEHMQRRLRDLAVRHKCIGDV 356 ********************************************************************* PP TIGR00700 347 rglGamiavelv.dpdttePdaalaekiaaaalaaGlllltaGifGniirlltPltisdelldeglkil 414 rglGam+ave+ d d + P +a+++ aaal++Gllll++G +Gn++rl+ Plti + ldegl++l lcl|NCBI__GCF_000310185.1:WP_004314496.1 357 RGLGAMVAVEFFhDGDHARPAPEIAKAVIAAALQRGLLLLSCGSYGNVLRLMVPLTIEQAVLDEGLDLL 425 **********98899****************************************************** PP TIGR00700 415 eaal 418 aa+ lcl|NCBI__GCF_000310185.1:WP_004314496.1 426 AAAM 429 9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (433 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.85 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory