Align aromatic-amino-acid transaminase TyrB; EC 2.6.1.57 (characterized)
to candidate WP_004316281.1 C665_RS14260 aspartate/tyrosine/aromatic aminotransferase
Query= CharProtDB::CH_004054 (397 letters) >NCBI__GCF_000310185.1:WP_004316281.1 Length = 402 Score = 402 bits (1032), Expect = e-116 Identities = 204/398 (51%), Positives = 275/398 (69%), Gaps = 3/398 (0%) Query: 1 MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAE-ARLNAQ 59 +F V+ DPIL L E F D R++KVNL +G+YY+++G IP L AV AE ARL A Sbjct: 5 IFAAVEMAPRDPILGLNEAFAADTRAEKVNLGVGVYYDDNGKIPLLAAVRTAEKARLEAM 64 Query: 60 PHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYF 119 P Y P+EG Y +A+ LLFG D + + T++ LGG+GALKVGAD+LKR Sbjct: 65 PPRG--YQPIEGPAAYNNAVQGLLFGKDSQLATSGQTITVEALGGTGALKVGADYLKRLV 122 Query: 120 PESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLLH 179 P + V++SDP+WENH A+F AGF V YP+YD AT GV F + A L +L SI++LH Sbjct: 123 PGATVYISDPSWENHRALFESAGFPVENYPYYDAATRGVNFAGMKAKLDSLQPGSIIVLH 182 Query: 180 PCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPA 239 CCHNPTGADL++ QWD V+ + + R LIPFLD+AYQGF G++ DA A+RA++++GL Sbjct: 183 ACCHNPTGADLSDAQWDEVVAVCRERGLIPFLDMAYQGFAEGIDADAVAVRALSASGLQF 242 Query: 240 LVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVL 299 VS+SFSK FSLYGERVG LS++ E AGRVL Q+K +R NYS+PP G +VAAVL Sbjct: 243 FVSSSFSKSFSLYGERVGALSIVTASKEEAGRVLSQVKRVIRTNYSNPPIHGGAIVAAVL 302 Query: 300 NDEALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQV 359 + L+ W E+ MR RI AMR LV+ L ++F +++ QRGMFSYTGL+AAQV Sbjct: 303 SSPELRQMWEDELGGMRERIRAMRTGLVEQLKAAGVAQDFSFVIKQRGMFSYTGLTAAQV 362 Query: 360 DRLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM 397 ++L+ +FG+Y +++GR+C+A LN+ N+ VAKA A V+ Sbjct: 363 EKLKADFGIYAVSTGRICLAALNSKNIGYVAKAIAQVV 400 Lambda K H 0.320 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 402 Length adjustment: 31 Effective length of query: 366 Effective length of database: 371 Effective search space: 135786 Effective search space used: 135786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory