Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate WP_004321319.1 C665_RS15305 glutamate-1-semialdehyde-2,1-aminomutase
Query= BRENDA::Q9I6M4 (426 letters) >NCBI__GCF_000310185.1:WP_004321319.1 Length = 427 Score = 185 bits (470), Expect = 2e-51 Identities = 130/376 (34%), Positives = 185/376 (49%), Gaps = 36/376 (9%) Query: 1 MSKTNESLLKRRQAAVPRGVGQI---------HPVVAERAENSTVWDVEGREYIDFAGGI 51 M+ NE+L++R Q ++P GV P RAE + VWD +G+EYID+ G Sbjct: 1 MTSRNEALIQRAQRSIPGGVNSPVRAFRSVGGTPRFLARAEGARVWDADGKEYIDYVGSW 60 Query: 52 AVLNTGHLHPKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDFPKKTLLVTS 111 GH HP +I AV+E L F E +++AE I +P + LV+S Sbjct: 61 GPAIAGHAHPAIIEAVRE--AALKGLSFGA-PTESEVDMAELICAMLPS--VEMVRLVSS 115 Query: 112 GSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLM------PG 165 G+EA +A+++AR TGR ++ F G YHG L AG GL+ G Sbjct: 116 GTEATMSAIRLARGFTGRDAIVKFEGCYHGHADSLL--------VKAGSGLLTFGNPSSG 167 Query: 166 GIFRALAPCELHGVSEDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKSFMQR 225 G+ A + V + + + +E +FK A+ +IAAII+EPV G F++ Sbjct: 168 GVPADFAKHTI--VLDYNDLQQVEDVFK--ARGDEIAAIIVEPVAGNMNLIKPQPGFLEG 223 Query: 226 LRALCDQHGILLIADEVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFPISGVAGKAE 285 LR +C ++G +LI DEV TG R G GI PDLTT K +GGG P+ G+ + Sbjct: 224 LRRICTEYGAVLIFDEVMTGF-RVGPQGVQGLYGITPDLTTLGKVIGGGMPVGAFGGRRD 282 Query: 286 IMDAIAPGG---LGGTYAGSPIACAAALAVLKVFEEEKLLERSQAVGERLKAGLREIQAK 342 IM+ IAP G GT +GSP+A AA + L++ E ER A +RL AGL Sbjct: 283 IMEKIAPLGSVYQAGTLSGSPVAVAAGMVSLQLTREAGFYERLTASTQRLVAGLAAAAKD 342 Query: 343 HKVIGDVRGLGSMVAI 358 V +G M + Sbjct: 343 AGVTFSADSVGGMFGV 358 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 29 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 427 Length adjustment: 32 Effective length of query: 394 Effective length of database: 395 Effective search space: 155630 Effective search space used: 155630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory