Align cyclohexa-1,5-dienecarbonyl-CoA hydratase monomer (EC 4.2.1.100) (characterized)
to candidate WP_004322547.1 C665_RS16085 enoyl-CoA hydratase
Query= metacyc::MONOMER-18320 (256 letters) >NCBI__GCF_000310185.1:WP_004322547.1 Length = 254 Score = 113 bits (282), Expect = 4e-30 Identities = 86/264 (32%), Positives = 127/264 (48%), Gaps = 24/264 (9%) Query: 5 TILFEKKDKVATITLNVPNS-NWLTIPMMKEINEALMDVKKDPTIQLLVFDHAGDKAFCD 63 ++ E D V + LN ++ N L + KEI++AL+ + ++ ++ K FC Sbjct: 3 SVAVECADGVGHLELNRADALNALDLQFCKEIDDALLALDAREDVRAILIS-TSLKHFCA 61 Query: 64 GVDVADHVPEKVDEMIDLFHGMFRNMAAMDVTS---------VCLVNGRSLGGGCELMAF 114 G D+ EM+D+ R M + S + V G + GGGCEL+ Sbjct: 62 GADIR--------EMLDMSAEQARAMGFVGCVSAPPRLRKPLIVAVRGLAAGGGCELVEM 113 Query: 115 CDIVIASEKAKIGQPEINLAVFPPVAAAW-FPKIMGLKKAMELILTGKIISAKEAEAIGL 173 CDIV+A+ A+ PEI LA P +++G AM+L+LTG+ +SA EA GL Sbjct: 114 CDIVVAAASARFCHPEITLAAMPGAGGTQRLARVVGKHVAMDLLLTGRALSADEALVAGL 173 Query: 174 VNVVLPVEGFREAAQKFMADFTSKSRPVAMWARRAIM-AGLNLDFLQALKASEIIYMQGC 232 V+ V+P E AA S S PVA + A+ A + LD AL+ C Sbjct: 174 VSRVVPDEALEAAAMSVARLVASYSSPVACRIKAAVNGAQVGLDAGLALERE---LFHAC 230 Query: 233 MATEDANEGLASFLEKRKPVFKDK 256 + D EGLA+F EKRKP F+ + Sbjct: 231 FSEHDFREGLAAFTEKRKPRFEHR 254 Lambda K H 0.322 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 254 Length adjustment: 24 Effective length of query: 232 Effective length of database: 230 Effective search space: 53360 Effective search space used: 53360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory