Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_004323276.1 C665_RS16635 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A165KER0 (358 letters) >NCBI__GCF_000310185.1:WP_004323276.1 Length = 346 Score = 161 bits (408), Expect = 2e-44 Identities = 105/342 (30%), Positives = 176/342 (51%), Gaps = 35/342 (10%) Query: 4 TKTNWI-IGAVALLVLPLILQSFGNAWVRIADLALLYVLLALGLNIVVGYAGLLDLGYVA 62 T+ W+ I AVAL+ P + + W+ +A L + + GLNI+ GY GL+ LG A Sbjct: 21 TQHAWLAILAVALIGFPFLADEY---WLYLACLVAINIASTTGLNILTGYTGLVSLGQAA 77 Query: 63 FYAVGAYLFALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLK 122 F +GAY A + L + + + +A G ++G P+L+ Sbjct: 78 FMGIGAYTVAALEQK----------------LGAPVLLNLLAGGFVAMLGGLVVGLPSLR 121 Query: 123 LRGDYLAIVTLGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLEVFGFD 182 ++G YLAI T+ ++ N H V T G G+ + + E+ G Sbjct: 122 VKGLYLAIATIAASVVLHFVFANW-HAV--TGGHAGITLVPA------------EILGLS 166 Query: 183 INSVTLYYYLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNMKLLAFG 242 ++ Y+LF+ + ++ V L +RIGRA++AIR+ +I+A+ +GI KLL+FG Sbjct: 167 FDTSFRLYWLFVPITILMVAGAANLFRTRIGRAFIAIRDRDISAEVLGIPLLRYKLLSFG 226 Query: 243 MGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVILGAVLLSALPE 302 + + + GV+G M+ F V+PESF L+ S+ +A V++GG+G I G ILGAV ++ +PE Sbjct: 227 LSSFYAGVAGGMWAYFFRVVTPESFPLILSIFFLAAVIVGGMGTILGAILGAVFMTMVPE 286 Query: 303 VLRYVAGPLQAMTDGRLDSAILRQLLIALAMIIIMLLRPRGL 344 L+ V G L D L + +R ++ + ++ ++ P GL Sbjct: 287 ALKLVVGWLPLSADATLILSPVRTIVFGVLIVGFLVFEPLGL 328 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 346 Length adjustment: 29 Effective length of query: 329 Effective length of database: 317 Effective search space: 104293 Effective search space used: 104293 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory