Align Fructokinase; D-fructose kinase; Manno(fructo)kinase; EC 2.7.1.4 (characterized)
to candidate WP_004325323.1 C665_RS17905 ROK family protein
Query= SwissProt::P23917 (302 letters) >NCBI__GCF_000310185.1:WP_004325323.1 Length = 301 Score = 320 bits (821), Expect = 2e-92 Identities = 160/299 (53%), Positives = 204/299 (68%), Gaps = 3/299 (1%) Query: 2 RIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIATLVDMAEQATGQRGTVG 61 RIGIDLGGTK E++ L G + +R R+PTP+ DY T+ IA LV+ AE+ TG +G Sbjct: 4 RIGIDLGGTKIELVVLDADGRERWRRRVPTPQGDYGGTLRAIAALVEEAERLTGAGARIG 63 Query: 62 MGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAAAG 121 +G PGS SP G ++NANST LNGQP +DL A L+R +RLANDANCLA+SEA DGA AG Sbjct: 64 VGTPGSPSPRDGRIRNANSTCLNGQPLQQDLEALLRRPLRLANDANCLAMSEAADGAGAG 123 Query: 122 AQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPCYCGKQ 181 A+TVFA I+GTG G G+ + + +G N AGEWGHNPLP D+L CYCG+ Sbjct: 124 ARTVFAAILGTGVGGGIVVDQKLLVGANAVAGEWGHNPLPLPAPDDLPL---PACYCGRA 180 Query: 182 GCIETFISGTGFAMDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKSLAHVVN 241 GCIET++SG G A D+ R G L + I R E ++ +L RYELRLA++LA V+N Sbjct: 181 GCIETYLSGPGLAADHLRHGGEPLDAAAIARQATEGQRASQASLERYELRLARALAGVIN 240 Query: 242 ILDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPVRKAKHGDSSGVRGAAWLWP 300 +LDP+VIVLGGG+S + RLY+ V + VF T + A+HGD+SGVRGAAWLWP Sbjct: 241 LLDPEVIVLGGGLSQIARLYEHVPRRWAAHVFSDTVSTRLLPARHGDASGVRGAAWLWP 299 Lambda K H 0.318 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 301 Length adjustment: 27 Effective length of query: 275 Effective length of database: 274 Effective search space: 75350 Effective search space used: 75350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory