Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate WP_004511425.1 GMET_RS08235 ROK family protein
Query= curated2:Q9KCZ4 (330 letters) >NCBI__GCF_000012925.1:WP_004511425.1 Length = 324 Score = 194 bits (492), Expect = 3e-54 Identities = 115/318 (36%), Positives = 178/318 (55%), Gaps = 11/318 (3%) Query: 4 RWYVGVDVGGTTIKMAFLTTAGEIVDKWEIPTNKQDGGALITTNIADALDKRLSGHHKSK 63 R Y+G+D+GGT ++MA + G I+ K + T+ G + + + ++ L + Sbjct: 6 RAYIGIDIGGTNLRMALIDERGAIIHKTKSRTDIHHGRSSFLSRLGKGIESLLLAARDNN 65 Query: 64 SDLIGIGLGAPGFIEMDTGFIYHAVNIGWRD-FPLKDKLEEETKLPVIVDNDANIAALGE 122 + G+G G PG I D G +Y +VN+ D L+D+L+ + LP +V ND N A GE Sbjct: 66 IEPAGLGAGVPGLIAND-GHVYVSVNLRPLDGVNLRDELQAMSGLPAVVANDVNAFAFGE 124 Query: 123 MWKGAGDGAKNMLLITLGTGVGGGIVANGNILHGVNGMAGEIGHITVIPEGGAPCNCGKT 182 GAG ++ L++TLGTGVGGG++ +G + G++G+AGE GH+TV E G PC CG Sbjct: 125 SVYGAGRDYRSFLMVTLGTGVGGGLILDGKVWSGIDGVAGEFGHMTVESE-GRPCPCGNR 183 Query: 183 GCLETVASATGIARIATEGVTEHKE---SQLALDYDKHGVLTAKDVFSAADASDAFALSV 239 GCLE ASA+ + A E + + K+ +Q +D +L A +A D + A AL + Sbjct: 184 GCLEQYASASALVSAAREMICQQKDVFGAQCDMDAISTKILAA----AALDGNQA-ALGL 238 Query: 240 VDHIAYYLGFAIANLANALNPEKIVIGGGVSKAGDTLLKPIKQHFEAYALPRVADGAEFR 299 YLG A A++AN LN E I++GGGVS + + L + +++ A A P R Sbjct: 239 FADAGRYLGIAAASVANLLNLEAIILGGGVSSSFNLLCESMRREVLARAFPIPGKRLVIR 298 Query: 300 IATLGNDAGVIGGGWLVK 317 A+LG+D G++G L + Sbjct: 299 QASLGDDGGILGSAALAR 316 Lambda K H 0.316 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 324 Length adjustment: 28 Effective length of query: 302 Effective length of database: 296 Effective search space: 89392 Effective search space used: 89392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory