Align 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; BCKDE1A; BCKDH E1-alpha; EC 1.2.4.4 (characterized)
to candidate WP_004511701.1 GMET_RS13835 pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
Query= SwissProt::P12694 (445 letters) >NCBI__GCF_000012925.1:WP_004511701.1 Length = 325 Score = 176 bits (445), Expect = 1e-48 Identities = 110/318 (34%), Positives = 160/318 (50%), Gaps = 3/318 (0%) Query: 97 LPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEEGTHVGSAAALDNTDLVF 155 LP +++++Y+ M L + E +G I+ ++ Y G+E VG+ A L D + Sbjct: 9 LPDAELIRMYEQMVLSREFEESCAEQYTKGHITGFLHLYSGQEAVAVGATAGLHRDDYIL 68 Query: 156 GQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQ 215 YRE + R MA+ +G + + KG+ +H F+ + + Q P Sbjct: 69 SAYREHAQAIVRGAEPRRVMAELFGKRTGICKGKGGSMHLFDPNLSFMGGYAIVGGQFPI 128 Query: 216 AVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPT 275 AVG A+AAK R+V C+FG+GAA++G H N+A E P++F C NN Y I T Sbjct: 129 AVGLAFAAKFRKEGRIVACFFGDGAANQGTFHESLNWARLWELPVLFICENNSYGIGTSV 188 Query: 276 SEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGH 335 I R GY I S RV G DV AVY A K A +N+PFLIEA+TYR Sbjct: 189 ERASALPDIHRRTCGYDIPSERVHGMDVIAVYEAVKWAAEWVREQNRPFLIEAITYRFRG 248 Query: 336 HSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFE 395 HS SD YRS+ EV W +D PI + L+ + E Q + ++Q+ V +A + Sbjct: 249 HSMSDPGK-YRSLAEVELWKSRD-PIPAFANRLVEEEIATEAQLEGIKQQALVTVADAVK 306 Query: 396 QAERKPKPNPNLLFSDVY 413 AE P P + ++ DVY Sbjct: 307 FAEDSPWPEDSEVWEDVY 324 Lambda K H 0.320 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 325 Length adjustment: 30 Effective length of query: 415 Effective length of database: 295 Effective search space: 122425 Effective search space used: 122425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory